KEGG   Saccoglossus kowalevskii (acorn worm): 100369770Help
Entry
100369770         CDS       T04123                                 

Definition
(RefSeq) phosphatidate cytidylyltransferase 1-like
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko01100  Metabolic pathways
sko04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100369770
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100369770
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     100369770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_1 CSTF_C
Motif
Other DBs
NCBI-GeneID: 100369770
NCBI-ProteinID: XP_006817141
Position
Un
AA seq 460 aa AA seqDB search
MDTELRHRGGETADNAEDITQAVTTETTKEDDVAPKTTAASSHIPPQVDDILPNLDDKKP
LIPPQQDTVPEVLKGLPPRWRNWIIRGIWSIIMVAGFLLIIWIGPLGLVALIMLIQLACF
REIINIGYAVYKSQDLPWFRTLSWYFLLCANYFFYGESTKDYFGILVHKDLEFLQPLADY
HRFISFTLYVLGFCAFVLSLVKQHYLVQFTLFGWTHVTLLIVVTQSHLLVQCIFEGLIWF
LLSTSMIICNDIMAYIFGFFFGRTSLIKLSPKKTWEGFIGAFFSTVLYAFAMAYFLAPYQ
HFVCPANYDDDLKRITMDCEPSSTFIMTEYNIPVIIRAILGLFGIHQSTIWLYPIQIHAL
ALATFASLVSPFGGFFASGFKRAFKIKDFGDVLPGHGGIMDRFDCQYLMASFLHVYLSSF
IRTANPAKLLQQVLQLNPDQQLNVFLQFQEHLIKNGLLKA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggacactgaacttaggcacagaggaggtgaaactgccgataatgccgaagacatcaca
caagctgtgacaactgaaacgacgaaagaagatgacgtcgctccaaagactacagctgct
tcatctcacatacctccccaagttgatgatattttacctaatttagatgacaagaagcca
ctgatacctccgcaacaagacacagtacctgaagtactgaaaggtctgccaccaagatgg
agaaattggattatccgcggtatttggagtattataatggttgcagggtttttgctcatc
atttggattggtccactcggtttagtcgcattgatcatgttgatacagctggcctgtttc
cgtgagattattaatatagggtatgcagtgtacaaatcacaggatctaccatggtttagg
acgctcagttggtatttcctactttgtgcaaattactttttctatggagaaagtaccaag
gactactttggaattttggtacataaagacttggaatttctacagccacttgcagattat
catcggttcatttccttcactctatatgtacttggcttctgtgctttcgttctatcccta
gtgaaacagcactatctggtgcagttcactttgtttggctggacccatgtaacattgttg
attgttgtgactcagtctcatctgctggttcagtgtatctttgaaggcttgatatggttc
ctactctccacttctatgattatctgcaatgacataatggcttatatctttggtttcttc
tttggtcgcacttcccttattaagctgtctcctaaaaaaacatgggagggtttcattgga
gcatttttctctactgtactctatgcttttgctatggcgtattttctggctccataccaa
cattttgtatgcccagcaaattatgatgatgacttgaagcgtattactatggactgtgaa
ccatcatccacatttatcatgacggaatataatataccagtcataatacgagcaattctt
ggactgtttggaatacatcaaagtactatctggttgtacccgattcaaattcatgccttg
gcattggcaacgtttgcttcgctggtcagtccatttggtggattctttgcaagtggattc
aaaagagctttcaaaataaaagattttggcgatgtattacctggtcatggtggaatcatg
gacagatttgactgtcagtatctaatggcttcatttcttcatgtgtatttaagcagtttt
atcaggacagcaaaccccgccaaattactgcagcaggtgttgcagctgaatccagaccaa
caattgaatgttttcttacagtttcaagaacatctcatcaaaaacggtttgctgaaagcc
tga

DBGET integrated database retrieval system