KEGG   Saccoglossus kowalevskii (acorn worm): 100371198Help
Entry
100371198         CDS       T04123                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100371198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100371198
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sko03036]
    100371198
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100371198
Protein kinases [BR:sko01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100371198
Chromosome and associated proteins [BR:sko03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100371198
   Centrosome duplication proteins
    Regulators of centriole replication
     100371198
  Sister chromatid separation proteins
   Polo kinases
    100371198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like Haspin_kinase Kdo DRMBL
Motif
Other DBs
NCBI-GeneID: 100371198
NCBI-ProteinID: XP_002731770
Position
Un
AA seq 666 aa AA seqDB search
MLISKATQAVALRMKDVKGQMERQLEGNNNKQRLKQQASTGSTDTLTEDPDVISDPTSDK
QYVRGRLLGKGGFARCYELTESTSKVLYAGKIIPKTRISKPHQRQKLEREIHLHSQLAHH
NVVQFLDYFDDDEHVYIILEICNKKSLMHTMRQRKTLTEPEVRFFLLQIIEGIQYLHSQN
VIHRDLKLGNILVSDSMEIKLADFGLATRLEFDGDRKRTICGTPNYIAPEVLEKIGHSYE
ADIWAIGCVMYTMLVGKPPFEGSTLKETYSRVRNNKYNLPFSLHSSAKDLIKQLLNSKPE
DRPGLEEILQHEFFTRGFTPTYLPPSVCHTAPRYATTDAGAVDVVDGDYKSREEPRRRFS
ELSSALQHLRGGRAKVTSKPPTPPSTSKHRRSSTDKTKAVTHAIKNAVSSVIESSKGQSP
PKSSNNIPPSKVQEMLMTCTRHMPEEPYNSTPKYKPKGSEVLWVTKWVDYSNKYGFGYQL
SDTSVGVMFNDNSRICFLPNRSTVQYIGVDRKVQIFAMTSVPQRLANKVTLLDYFATYMD
EHLIKGGDLESKEKSSPTKRKVLQSEPGTAVQPFMQNWTKTKDSITMYLSNGALQINFFE
DHTKIVLSYNNSDHLVTYVDNERICHTYRLLHVAHYGCPAHLHARMLYSVNAVKNIVAQE
AATTST
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgctcatatcgaaggcaacacaagccgtagctcttcgaatgaaggatgtcaaaggacaa
atggaaaggcaactcgaaggcaacaataacaaacaaagactcaaacaacaggcttccact
ggtagcacggatacattgacagaggacccagatgttatttcggacccgacctcagacaag
cagtatgtgaggggtcggctgttgggcaagggcggttttgcgagatgttacgaacttacg
gaatctacctcaaaagtgttgtacgcgggcaagatcattccaaaaactcgaatatctaaa
cctcatcaaagacagaagcttgagcgagaaatccatctgcactcccagcttgcgcaccat
aacgttgtacagtttctggattacttcgacgatgatgagcacgtctatatcatcctcgaa
atctgtaataaaaagtctctgatgcacacaatgaggcaacgaaagactctgacggaaccg
gaagtgcgttttttcctcctccaaatcattgaaggaatacaatatttacatagccagaat
gtgatccacagagatttgaagcttggaaacattttagtctcagacagtatggagattaag
ctagctgacttcggtctggcaacgagattagagttcgacggcgatagaaaaaggacgatt
tgtggaacgcctaactacattgcaccagaagttttagagaagattggccatagctatgag
gctgatatctgggctattggttgcgtcatgtacactatgcttgtcgggaagccacccttc
gaaggaagtactttaaaggagacctactctagggttagaaacaacaaatacaatctacca
ttcagcctccattcctcagcgaaagatcttataaaacagctattgaacagtaaaccggaa
gatcgcccgggtttggaggagatcttgcagcacgagtttttcacccgtgggtttacgccc
acatatctaccgcccagcgtgtgtcacactgccccaaggtacgccacaaccgacgctgga
gctgtcgacgtcgtggatggggactacaaatcacgcgaagagcccaggagaagattttct
gaactctcatcggcacttcaacatctccgaggaggtagagctaaggtaaccagcaaacct
ccgacacccccctccactagtaaacatcgtcgaagttcaacagacaaaaccaaagctgtt
actcacgctattaaaaatgctgtttcttcagtgattgaatcatccaaaggccaatcgccg
ccaaagtccagcaacaacattcccccaagcaaagttcaagagatgttaatgacatgtacg
cgacacatgcctgaagagccctacaatagtacacccaagtacaaacctaaaggttcagag
gtactctgggttaccaaatgggtcgactactctaataaatacgggtttgggtaccagtta
tccgatacatcggttggtgtcatgttcaacgacaactcgagaatttgttttcttccaaac
agaagcactgtacagtacattggagttgaccgaaaagtccagatattcgcaatgacatca
gtgccccagcgtctggccaataaagtgaccttgctcgactatttcgctacatacatggac
gagcatctgataaagggaggcgatttagaatcaaaggagaagtccagtcctacgaagagg
aaagtgttgcagagtgagccaggaacagccgtacagccgtttatgcagaattggacgaag
accaaagattccatcactatgtatctcagtaacggtgcattgcagatcaatttcttcgag
gaccacaccaagattgtccttagttacaacaacagtgaccacttggtaacatacgtggac
aatgaacgtatttgccacacgtatcgtttgttgcacgtggcgcactacggatgccccgct
catctacatgcacgaatgttgtacagtgtgaacgcagtcaaaaatattgtggcacaggaa
gcggcaacgacgtccacataa

DBGET integrated database retrieval system