KEGG   Saccoglossus kowalevskii (acorn worm): 100371623Help
Entry
100371623         CDS       T04123                                 

Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7-like
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100371623
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100371623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 100371623
NCBI-ProteinID: XP_006818777
Position
Un
AA seq 1338 aa AA seqDB search
MATDIGGVVNEIGVHIGDVAQLVPDIVQYNQLTATILLSVAVIASIACIVLFIFLHKIKR
QVMGQTPGPGQTKPRFRKRDKVIFYGRRMLRKVKSISGPITSTRTKLMKRKRLIGDLKRL
LSRTKESGPVLQEKEPPPAVLEADWREIQQSELTIPPEVIYMLKSVRVFGHFEKPLFLEL
CRHMETKFIMAGSYLFRKGQPDDSIYVVQSGKLSVYISEKDGSESVMKEVCAGDSVHSLL
SVLDVITGHPAPYKTVSARAVVDTTILKLPAQAFCTVFENYPESLVRVVQIIVVRLQRVT
FMALHNYLGLSNELINPENQSNKDFSVHNISPKTSPTKRSLNQELSVESMENETVTEIID
FDQDYLPEISPSKSQHDAVISDSPLKGSMTYMAELLDTQQRRSRSSSLPAGARRPPLEHS
GRASSLDRDSATSLGTSPSDFDAVVGQARVQGFDDKVLFVASSPSNEELDEIQPEVTSSK
SRPDTLFSSEKINKKEKKVVFPKQEEKLTPDDDEILQMAINDLTVLLGLEDDSLLKSKVS
LVRVSAGKYLTREGDQDCSLYFVVTGCLGMHQKRVGIKGEENTVFIAHPGELVGTIAVLT
GEPSFFTIRARKDSRVVVVSKTNFYSIMRASPRVVLNVAHSIVRRLSPFVRQIDFALDWM
HLEAGRAVFRQDDESDCTYIILNGRLRSVATLENGKKELVGEYGRGDLVGIVEVLTQSKR
VTTVHAVRDTELAKVPEGLLNTIKRKYPQVVTRLIHLLGQRILGTITGKSLGGFRLTDPL
RFSERPSASTLSNLSTVAVLPVSSDVPLSSFTVELEHALCSIGTTLRLTSEHIRDRLGSA
ALDSINEFRLASWLAQQEDIHRITLYQADFRMTPWTLRCIRQADSILIVGLADKDPNIVG
DSEKQLETLAVRAQKELVLLHKEVNGSYKEPRRTVEWLNTRGWVSSHHHIRCPKRIFSKR
SAQKRQDMYKKLFERPPDRHSDFSRLARFLTGTSIGLVLGGGGARGSSEVGIMKAMEENS
IPIDIIGGTSIGSFVGALYADEVNADAVSRRAKEWCKEMGTYWSKILDLTYPVTAMFTGG
SFNRSIEDVFRNKQIEDLWLPFFVISTDISSSSMRVHTSGSLWRYVRASMSLSGYLPPLC
DPKDGHLLLDGGYVNNLPADVMKSMGAQTIIAVDVGSQDVTHLTNYGDTLSGWWLLWKRW
NPWASAVRVPDMTEIQSRLAYVSCVRHLEELKNSRMCEYIRPPIDRFKTLEFNRFDEIKE
VGYQHGMTVFSGWQKGKSCGICSKKRRKREQLQDEDYQLYLNLRGVKDWRNTRTSDESDD
TETTVWTPKRAASDIYYY
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgatattggcggtgttgtgaatgagatcggggtccatataggcgatgtggcg
caacttgtaccggatattgttcagtataatcaactaactgcgaccatattattatctgtc
gctgtcatcgccagtatagcatgtattgttttatttatattcctacataaaattaaaaga
caagttatgggacagactccaggtcctggccaaacaaagccacgttttaggaaaagagat
aaagttatcttctatggaaggcgaatgttgagaaaggtgaagtccatctcagggcctatc
accagcactagaacaaaactaatgaaaaggaagaggttaattggggatctgaagaggtta
ctgagtaggacaaaggagtcaggtccagtgctgcaggagaaagaacccccgccagcagta
ttagaagcagattggagagaaattcaacaatcagaacttactataccaccagaagttatt
tatatgttaaaaagtgtcagagtgttcggccattttgaaaagccactttttttagaattg
tgcagacatatggagactaagttcatcatggccgggtcttatctttttcgtaaaggtcaa
cctgatgacagtatctatgtagtacaaagtggtaaacttagtgtatatatttcagaaaaa
gatggctctgaatcagtgatgaaggaagtctgtgctggtgacagtgtgcacagtctactc
agtgtattggatgttataacaggtcatccagcaccgtataaaactgtgtcagctcgtgct
gtagtggacaccactattctcaagttacctgcccaagcattttgtactgtgtttgaaaac
tatccagaatcactagttagagttgtacagatcatcgttgtacgcttacagagagtgact
ttcatggcgttacacaactaccttggtctgagtaatgaactgatcaacccggaaaaccaa
agcaacaaagatttctctgtacataatatatcaccaaagaccagtcccaccaaaagatca
ctcaatcaagaattgtctgtggagagtatggagaatgagacagtgacagaaataattgat
tttgaccaagattatctaccggaaatcagtccaagcaaaagtcaacatgatgcggtgata
agtgacagtcctcttaaagggagcatgacttatatggctgaactgcttgatacacaacaa
cgaagatctcggagttcctcgttaccagcaggtgcaagaagaccacctcttgaacatagt
ggtagagccagttcattggatcgggacagcgccacaagtttgggtacctctccttcagat
tttgatgcagtggtaggccaggctagagtacagggttttgacgacaaagtgttgtttgtt
gcatcgtcaccgtccaatgaggaattggatgaaatacaacctgaagtaacgtcttctaag
agtcgtccagatacgctattctcttcagaaaagataaacaagaaagagaaaaaagtagtg
tttccaaaacaggaagagaaactgactccagatgatgatgagatattacaaatggctatc
aatgatttgacggttctactcggattagaggatgattctttgttgaaaagtaaagtgagt
ttagtccgtgtatctgcaggaaagtatctgacaagagaaggtgaccaggattgtagtctg
tatttcgttgtgacgggctgtcttggaatgcaccaaaagagagtgggaatcaaaggagag
gagaacactgtgtttattgcacatcctggtgagctggttggtaccattgctgtgctgaca
ggcgaaccttctttctttactatccgtgcaagaaaagactctagggtggtggttgtctca
aaaactaatttctacagtataatgagagctagccctagagtggtgctgaatgtagcacac
agtattgtacgaagactttcaccgtttgttagacagattgattttgctctagattggatg
catcttgaggctggtagagctgtattcagacaagatgacgaatctgattgcacgtatatt
atactgaatggccgtttgagatctgtcgccaccttggaaaatggtaaaaaggaattggta
ggggagtatggtaggggagatctagttggtattgtggaagttttaacacaaagtaaacgg
gtcaccacagtacatgcagtgagagacactgagcttgccaaggtaccggaaggtcttctg
aacaccatcaaacggaaatatccacaagtagtgaccaggttgattcatttactgggtcaa
agaatcctgggaaccatcactggcaaatcgctgggtgggtttagattgacagatccactg
cgtttctcagaacgtccgagtgctagcaccctgtctaatctatccacggtagcagtgctt
cctgtatccagtgatgtaccgttgtccagttttactgttgagttagagcatgctctgtgc
tccattggtacaacactgagactgacgagtgaacacataagagatagattgggaagtgct
gctctagacagtataaatgagtttcgacttgctagctggcttgcacagcaagaggatatt
catcgtattactctataccaagctgacttcagaatgacgccatggacgctgaggtgtatt
agacaggcggactctattctaattgtggggctagctgacaaggatccaaacattgttgga
gacagtgaaaagcagcttgagactttggctgtgagggcgcagaaagaactggtcttactg
cacaaggaagtgaatggttcctacaaagaaccacgcagaacagtagagtggttgaatact
agggggtgggtttcatcacatcatcacatcaggtgccccaagagaatattttcaaaacgg
tcagcccaaaaacgtcaagacatgtacaaaaaattgtttgagagaccaccagacagacat
tcagacttctccaggctggccaggtttttgactggtacctctataggactggtattaggt
ggtggtggagctagaggctcttccgaagttggaatcatgaaagccatggaggagaattcc
ataccaattgatattattggcggaaccagtattggctcatttgtgggtgctctctatgca
gatgaggtcaatgcagatgctgtcagtcgacgagccaaagaatggtgcaaagaaatgggt
acatactggagtaaaatattagatttgacttaccctgttacagctatgtttactggggga
agctttaatcggtctatagaagatgtcttccgtaataaacaaatagaagatctttggctt
cctttctttgttataagtacagacatatccagctccagtatgagagtacatactagtggt
tctttatggcgatatgttagagccagtatgtcattatctggttacttacctcctctgtgt
gaccctaaagatggccatcttttattggacggtggatatgtcaataatttacctgctgac
gtcatgaaatctatgggtgcacagactatcatagcggtggatgtcggcagtcaggatgtg
actcatctaaccaactatggggacacactatcaggatggtggttgctatggaaaagatgg
aatccctgggctagcgctgttagggtgcctgatatgactgagatacagagcagattagcg
tatgtctcgtgtgtcagacatcttgaagagctgaagaatagtaggatgtgtgaatatata
agaccaccaattgacaggtttaaaactctagagtttaatagatttgatgagatcaaagaa
gttggataccaacacggaatgacagtgttcagtggctggcagaaaggtaaatcttgcggg
atatgttcaaagaaaaggagaaagagagagcagttacaggatgaagactatcaactatac
cttaatttgagaggagtcaaagattggagaaataccagaacttcagatgagtctgatgat
acagagacaactgtgtggacaccaaaaagagcagcgagtgatatttattattactga

KEGG   Saccoglossus kowalevskii (acorn worm): 100379026Help
Entry
100379026         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100379026
   00565 Ether lipid metabolism
    100379026
   00590 Arachidonic acid metabolism
    100379026
   00591 Linoleic acid metabolism
    100379026
   00592 alpha-Linolenic acid metabolism
    100379026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    100379026
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100379026
    3.1.1.5  lysophospholipase
     100379026
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100379026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2 MpPF26
Motif
Other DBs
NCBI-GeneID: 100379026
NCBI-ProteinID: XP_006820483
Position
Un
AA seq 445 aa AA seqDB search
MFTGWNTYVAELERLQNNSSSSELLKNVRSTNKPSGLKDFPCNVGIVKGEKVADSVHSLR
PGDVKVVGAIGDSLTAGNGARASVLPQCLIEYRGSSFSVGGANVLEKQITFPNILKKYNP
NVVGFSKGTSMKWFNDEDKSQFNVAVAGADAKDILGQARVLIKRMKSHHAVDFVNDWKIV
TVLIGGNDLCDWCDDKEIFKPERYISHIRETLDLLHSEMPRTFVNLLLAPNVIELAKLSG
ISCKVVHHFLCECASFGNEVKLMPILQQYRVLTKELVASGRYDTKDDFTVVLQPFLEKTT
IPTKKSGDVDYSYIAPDCFHFSVKGHEQASKALWHNMLEPVGNKSTLWMPGEPLRCPTQE
NPFFYTALNSESKPKSFATSYGGSAGEDNPSGRTVNSALIGFIGVLAILACVIITTMLVI
KSSKNKLKGKTEENEWLLTMNSVDA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggctggaatacatacgtagctgagctagaacgattgcagaacaacagttca
tcgtcagaactccttaaaaatgttcgatcgaccaacaaaccaagtggcttgaaagatttc
ccatgcaatgtaggtattgtgaaaggagagaaagtagcagattcagttcattcactgcgg
cccggtgatgtaaaggttgtcggcgcaatcggagattctctcacagctggtaatggagct
cgtgcatcagtacttccacaatgcttgattgaatacaggggatcatcatttagtgttggt
ggagctaatgttctcgaaaaacaaataacttttccaaatatcttaaaaaagtacaatcca
aatgtggtaggtttctcaaaaggaacgagtatgaaatggtttaatgatgaggacaagtct
cagttcaatgttgccgtagccggagcagatgctaaagatattttaggacaagcccgtgta
ttaataaagagaatgaaatcacatcatgcagtggattttgttaatgattggaaaattgtt
acagtattaattggtggtaatgacctttgtgattggtgcgatgacaaagaaatattcaag
ccagaacgttatatttctcacatcagagagacactggatcttttacactcggagatgcct
agaacatttgtaaatctgttgttggcacctaatgtgattgaattagcaaaactgagtgga
atctcctgtaaagtggtacaccatttcttatgtgagtgtgcatcctttggaaatgaagtc
aagttaatgcccattttgcaacaatatcgggttttaactaaagagttagtggctagtggt
agatatgacacaaaagatgacttcaccgttgtattacaaccgttccttgaaaagacaact
atcccaacaaaaaagtctggtgatgttgattattcatacattgccccagactgctttcac
tttagtgtcaaaggtcatgaacaggcgtccaaagctctgtggcataacatgcttgagcct
gttggaaataaaagtacattatggatgcctggtgagccgctgcgttgtccaactcaggaa
aacccgttcttttacacagcactgaatagtgaaagtaaaccgaaaagctttgctacctca
tacggtggtagtgctggtgaagacaatccaagtgggcgcacagtgaatagtgctttgata
gggtttatcggtgtacttgctattcttgcctgtgttattataactactatgctagtgata
aaaagcagcaagaacaaactgaaggggaaaacggaggaaaatgaatggctattgacaatg
aattctgttgatgcttaa

KEGG   Saccoglossus kowalevskii (acorn worm): 102805697Help
Entry
102805697         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102805697
   00565 Ether lipid metabolism
    102805697
   00590 Arachidonic acid metabolism
    102805697
   00591 Linoleic acid metabolism
    102805697
   00592 alpha-Linolenic acid metabolism
    102805697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102805697
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102805697
    3.1.1.5  lysophospholipase
     102805697
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102805697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 102805697
NCBI-ProteinID: XP_006820484
Position
Un
AA seq 445 aa AA seqDB search
MKTTIATVLFLAVFTGISDASGHWSDFVKAIYKASHYQEQSDLYESSNNGTLLPIPLPIE
FPDGSCTSVISPPEFPDLPRPPRDFPCSCVNPGTSAVSVHALSPFDVKIVGALGDSLTAG
SGADAAIIVGSLNDYRGVVYSIGGDEDFSAGVTTLPNILQEYSPSLKGFSLGVCNRDETA
SALNVASPGDVSRDMKYQAYRLIDRMKLHPDVDYELDWKVVTILIGGNDLCSFCDDKELY
TAERYQQHLQEALDVLHEGMPRAFINLVSVLQVAELSQLNGTICNIIHCLFCTCVKYGDD
QNELVELTKEYQRVTHELIDSGRYETSDDFTVVVQPFLEETTLPLDENGDPDKSYFAKDC
FHFSEKGHATAAVNLWNNMFEPVGLKSRVFNPEADVYCPTQDVPYFYTSKNSGIEPTTSS
SASPRISHVFYISSMVMLFEYSFWN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaactattgcgactgtgttatttcttgcagtcttcacaggaatctctgatgca
tctggacattggagtgattttgtgaaagccatatacaaagcatctcactaccaggagcag
tctgacttgtacgagtctagtaacaatggaacactactgcccataccattaccaatcgaa
tttcctgatggttcttgcacatccgttatatctccaccggaattcccagatttaccaagg
ccacccagagacttcccatgttcttgtgttaacccaggcacatccgcagtttcagtacat
gcattatctccctttgatgttaagatagttggggcattaggtgattcgctgacagcaggc
agtggagcggacgcagccattatagttggatcgttaaatgactacagaggtgtagtctac
agtatcggtggagacgaagacttttcggcaggagtcactactttaccaaatattttacaa
gagtatagcccgtcgctgaaaggattctctttaggagtttgtaatagagatgaaacggca
tcggctttgaacgttgctagtcctggtgatgtatcaagagacatgaagtaccaagcatac
cgacttattgacagaatgaaactgcacccagacgttgattatgaactcgactggaaagtc
gtaacgatcttaattggtggaaatgacctgtgctctttctgtgatgataaagaactgtac
acagccgagcgataccagcaacatcttcaagaagctttagacgtcttacatgaggggatg
ccaagggcttttattaatttagtttccgtattgcaagtagcagaattatcacaattaaat
ggcactatatgtaatatcattcattgtctgttttgtacttgtgttaagtatggtgatgat
cagaatgaactagttgagctcaccaaagaataccagcgtgtcacccacgaactcattgat
agtgggcgctatgaaacatcagatgactttacagttgtagtgcagccattcctagaagag
accactctaccacttgatgagaatggtgatccagataaatcatatttcgcaaaagactgc
tttcatttcagtgaaaagggacatgctaccgccgcagtgaatctttggaacaacatgttt
gaacctgttgggttaaagtctcgcgtgtttaaccctgaagccgacgtttactgtccaact
caggatgttccatacttttatacatcaaagaacagtggtatcgaacctacaacatcatca
tcagcgtcaccaagaatatctcatgtgttctatatatcatctatggttatgttatttgaa
tactcattctggaactga

KEGG   Saccoglossus kowalevskii (acorn worm): 102805811Help
Entry
102805811         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102805811
   00565 Ether lipid metabolism
    102805811
   00590 Arachidonic acid metabolism
    102805811
   00591 Linoleic acid metabolism
    102805811
   00592 alpha-Linolenic acid metabolism
    102805811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102805811
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102805811
    3.1.1.5  lysophospholipase
     102805811
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102805811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2 CytoC_RC
Motif
Other DBs
NCBI-GeneID: 102805811
NCBI-ProteinID: XP_006820485
Position
Un
AA seq 709 aa AA seqDB search
MKLFFVFILSIVSASGFENESPEERWERYVQVLREYGPDEKNIMVSNDTPRLLQYKFECD
ILAPSATKPDSVHKLRPADIDIVAALGDSLTAANGAGASNPFQVLIEYRGLSWSIGGDNT
LEDGTLTLSNILKMYNPNVKGWSIETGPADNHNISRLNVAVPGSTSIDMLEQVETLIQGL
KTVKTLDYDNDWKLVTLFIGGNDLCAYCRDNDSYSAEQYATNVKAALDLMHVERSLEMLV
EDGRYDTRDDFTVVIQPFFEETYIPPDGEGGWDGSMFAPDCFHFSEYGHQGCAMSLWNNM
IERVGEKRKAWLPEDKLECPSEDFEYFYTYKNSNETEQNMDPIGDLDPIGQAYVVTMPSL
TLLLTVMRIQHKFDCEIIPRSTTRPTSVHELTPGDIDIVAALGDSITAGNGAGASNPIQV
IREYRGLSWSIGGDGTMKDETLTLPNILKQYNPEVNGWSVGIGQIEDYNISRLNVAEPGG
KSKDLMDQTQNLIERLKHVDWLDYDNDWKMVTIFIGANDLCAYCHEPEEYTAENYAKNVE
ETLDYMHEEIPRTFVNLAQTVMVTEINKLDGCFCDLLHRFSCDCAKAKYSDDWRELLNLT
NAYHRALETLVESGKYDTHDNFTVVIQPFFEETRIPPDGEGGWDDSFFAPDCFHFSEYGH
QESAKSLWNNLIEPVGQKRTAWHPDDIVECPSEDFEYFYTYKNSPEITT
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttcttcgtttttattttgtcaattgtgtctgcatctggttttgaaaacgag
tctcccgaagaaagatgggaacgttatgttcaagttctccgagaatacggacctgatgaa
aagaacatcatggtatctaatgatacaccgagattactacagtacaaatttgaatgtgat
attctagcgccttctgccacgaaacctgactcggttcataaactacgtccagctgatatt
gacatcgttgctgctttgggagattctttaacggctgccaatggtgctggcgccagtaac
ccttttcaagtactgatcgagtacagaggactatcttggagtattggtggcgataacaca
ttggaagatggtactctaacgctgtcaaacattttgaaaatgtataacccaaacgtaaaa
ggttggtctatagagacaggtcccgcagataaccataacatctctagattaaacgtggcg
gtaccaggttccacttcaatagatatgcttgaacaggtagaaacccttattcagggtctg
aagacagtcaagactctagattatgataatgattggaaactggtaaccttattcataggt
ggtaatgatttgtgtgcttactgccgagacaatgatagctactcagccgagcagtacgcc
accaatgttaaggcagcgttggatttaatgcacgttgagcgctccctcgagatgttggtt
gaagatggtagatatgacacaagagatgactttactgtagtaattcaaccattctttgag
gagacttatataccacctgatggtgaaggtggttgggatggatctatgttcgcaccagac
tgttttcatttcagtgaatatggacaccaaggctgtgccatgagtctgtggaataatatg
attgaacgagtcggagagaaacgcaaagcatggcttcctgaagacaaattggagtgtcca
tcggaggatttcgaatacttctacacatataagaactcaaacgagaccgagcagaacatg
gatcccataggagacttggatcccataggacaagcatacgtggttactatgccatcactg
acattactgttaacagtcatgaggatacagcacaaatttgactgtgaaattatacctcga
tcaacgacaaggcctacgtcagtgcatgaactaacaccaggtgatattgatattgttgct
gctttgggggactctataacggctggcaacggtgctggggcttccaatcccatacaagtt
attcgcgaatatagaggactatcatggagtattggtggtgatggtacaatgaaagacgaa
acacttactttaccaaatattttaaaacaatataacccggaagtgaatgggtggtctgtt
ggtattggacaaatagaagattataatatatcacgtttgaatgtagctgaacctggaggt
aaatccaaggatctcatggaccagacgcaaaaccttatcgaaagattgaaacatgttgat
tggctggactatgataatgattggaaaatggtgactatatttataggcgctaacgatcta
tgtgcgtactgccacgaacctgaggagtatacagcggaaaattatgcaaaaaatgttgaa
gaaacattggattacatgcatgaagagataccgaggacgttcgttaacttagcacaaacc
gttatggtaactgaaataaacaaactggatggatgtttttgtgatctactacaccgtttc
tcttgtgattgtgcaaaggcaaagtattctgatgactggagagaactactgaacttgaca
aatgcatatcatcgtgcattggagacgttggttgaaagcggcaaatatgatacacacgat
aattttactgtagttatccaaccattcttcgaagagacacgtatacctcctgatggtgaa
ggtggatgggatgattcattctttgcgccagactgttttcatttcagtgaatacgggcac
caagaaagtgccaaaagtttatggaataatttgatagagccagtaggacagaaacgtaca
gcttggcaccctgacgacattgtagaatgcccatctgaggatttcgaatacttttacacc
tataaaaattcaccagagatcaccacctaa

KEGG   Saccoglossus kowalevskii (acorn worm): 102805942Help
Entry
102805942         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102805942
   00565 Ether lipid metabolism
    102805942
   00590 Arachidonic acid metabolism
    102805942
   00591 Linoleic acid metabolism
    102805942
   00592 alpha-Linolenic acid metabolism
    102805942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102805942
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102805942
    3.1.1.5  lysophospholipase
     102805942
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102805942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2 CytoC_RC CBM64 FSAP_sig_propep
Motif
Other DBs
NCBI-GeneID: 102805942
NCBI-ProteinID: XP_006820486
Position
Un
AA seq 425 aa AA seqDB search
MKLFLVFILTIVSVSCVEKNSTNGYWERFSRFMEEFGPIAEDIIAKKTPAIPRKQDYTFD
CEILPPSDTTPTSVHKLRPADIDVVAALGDSLTAANGAGASNPILVLREYRGLSFSIGGD
DTLEDGVLTLPNILKQYNSEVTGWSEGIGRVDNYEVSRLNVAVPGGKADDMYDQTVDLIN
RLKTHESLDYENDWKMVTLFIGGNDLCAYCHDPEDHTAEQYTKHIKTALDLMHAEMPRTF
VNLAQTVLVTEINKLDDCFCDLIHLFLCDCAKATWSDDWQEILILANKYHRALEELVEDG
RYDTREDFTVVIQPFFEETRIPPDGEGGWDDSFFAPDCFHFSEYGHQECAKSLWNNLIEP
VGQKRTAWHPDDIVECPSEDFEFFYTYKNSDKTPQQPEPVSQAHMVTMTPMLLVLFTATV
LQICV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtttcttgtttttattctgacgattgtatcggtgtcatgcgtagaaaagaat
tccacaaatgggtactgggaaagattcagccgctttatggaagaatttggacctattgct
gaggacataatcgccaaaaagacaccagctattcctaggaaacaggactatacatttgac
tgtgaaattctacctccatctgatacaacacctacttccgtccataaactgcgacccgct
gatattgatgttgttgccgctttgggagactctttaacggctgctaatggtgccggtgcg
tcaaatcccatactagttctacgagagtacagaggactatcattcagcattggtggtgat
gataccttagaggatggcgttctcactttaccaaatattttaaaacagtataattcagaa
gtaactgggtggtctgaaggaataggacgagtcgataactatgaagtatcaagattgaat
gtggcagtaccaggagggaaagcagatgatatgtatgatcagacagtggaccttatcaac
agattgaaaacccacgagtcattggattatgaaaatgattggaaaatggttactctattt
atcggtggcaatgacctgtgtgcatactgccatgacccagaagaccacactgcggaacag
tatacaaagcacattaaaacggcgttagatctgatgcatgcagagatgccgaggactttc
gttaatttagcgcagaccgtgctggttactgaaatcaataaattagatgattgcttttgt
gatcttatacacctttttctctgtgactgtgccaaagcaacgtggtccgatgactggcaa
gaaattctaatactggcaaataaatatcatcgtgcattagaggagttggttgaagatggt
aggtatgacacaagagaagattttactgtagttatccaaccattttttgaagagacacgc
atacctcctgacggtgaaggtggatgggatgattcattctttgcgccagactgttttcat
ttcagtgaatacgggcaccaggaatgtgctaagagtttatggaataatttaatagagcca
gtaggacagaaacgtacagcttggcaccctgacgacattgtagaatgcccatctgaggat
tttgaattcttctatacatataagaactcagacaaaaccccgcaacaaccagaacccgtg
tcgcaagcacatatggtaaccatgacacccatgttattagttctgtttactgccacggtt
ctacaaatatgtgtatga

KEGG   Saccoglossus kowalevskii (acorn worm): 102806057Help
Entry
102806057         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102806057
   00565 Ether lipid metabolism
    102806057
   00590 Arachidonic acid metabolism
    102806057
   00591 Linoleic acid metabolism
    102806057
   00592 alpha-Linolenic acid metabolism
    102806057
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102806057
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102806057
    3.1.1.5  lysophospholipase
     102806057
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102806057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2 DUF3377
Motif
Other DBs
NCBI-GeneID: 102806057
NCBI-ProteinID: XP_006820487
Position
Un
AA seq 481 aa AA seqDB search
MDESKECGMSSGDENGCGKDTGDESRAFGFLALVTLLPSIDSVKVDSQESLASPYLRNPD
ELAQLIDTPDEWKTKDFHSSLNEFNCEILPPSDTIPTSVHKLRPADINVVAALGDSITAG
FGAKSENISTISTQYRGISWSIGGDDSLEDGVLTLPNVLRKYNADLKGWSVETGGSRDYN
ISRLNVAIPGSRSTNMRRQAEDLVERLLFADSVDYINDWKVVTIFIGGNDLCASCNFPER
HSAQQYTENVKEALDYMHQTMPRTFVNLAQTVVVTETNKFNTSYCNQFSLCTCAKQWHND
DWEDVLQLTWDYHTGLKTLISTGQYDTREDFTVVIQPFFEETYVPPDGEGGWDHRMFAPD
CFHFNEYGHQACAMSLWNNMIEPVGAKRTAWRPGDILECPSEDFEYFYTYLNFRVSTTTA
NPLSDVSTSYPVDDEPTTTCEDYTGAFITAIVILSILLLVCFLGIIWLVYKMNSNGKAYL
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaagcaaggaatgtggaatgagttctggtgatgaaaacggatgtggaaaagat
actggtgatgaaagcagggcattcggcttcctcgcattagtcacgttattgccatcaatt
gactctgtaaaggttgattcccaagaatcattagcatctccgtatttacggaatcctgac
gaattagctcagctcattgatacacccgacgagtggaaaactaaagattttcattcatct
ctgaacgaatttaattgcgagattcttccaccatcggatactatccccacgtcagtacat
aaacttcgcccagcagacattaacgtcgtggcagctctcggagactcaataacggcgggg
ttcggagcaaaatcagaaaatattagtacaattagtactcaatacaggggaatatcatgg
agcattggaggtgatgatagtttggaggatggcgttctcacacttccaaatgttttgcgt
aaatacaatgctgatttgaagggctggtccgtggagactggtggtagtcgagactataac
atctcaagacttaatgttgcaattccaggatcaagatcgacaaatatgcggcgccaagct
gaagatcttgttgaacgtttactgtttgctgattcagtggactacatcaatgactggaaa
gtggtgacaatatttatcggtggtaatgatttatgtgcgtcttgcaattttcctgaaaga
cattccgctcaacaatatacagaaaatgttaaagaagccttggattatatgcatcaaacg
atgccgcggacatttgtcaatttagctcagacagtagttgtgacagaaactaacaagttc
aatacttcttactgtaatcaattctcactatgcacctgtgcaaagcaatggcataacgac
gactgggaggatgtgttacagttgacatgggattaccatacggggttgaaaactttgata
tctacgggacaatatgatacgagagaagatttcacggttgttattcaaccgttttttgaa
gagacatatgtacctcccgatggtgaaggtggttgggatcatagaatgtttgcaccagac
tgctttcatttcaacgaatatggacatcaagcatgtgcaatgagcctttggaataatatg
atcgaaccagtgggtgcgaaacggacagcatggcgtccaggtgacatattggaatgtcca
tcagaggatttcgaatacttttatacataccttaattttcgagtttcaactacaactgcc
aatccgctgagtgacgtctcaacgtcatatccggttgatgatgagcctactacgacatgt
gaagactatactggcgcttttatcacggcgattgtgatattgtctatactcctattggtc
tgtttccttggaatcatttggcttgtatataaaatgaattcgaatggaaaggcttacttg
aactga

KEGG   Saccoglossus kowalevskii (acorn worm): 102806173Help
Entry
102806173         CDS       T04123                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko00565  Ether lipid metabolism
sko00590  Arachidonic acid metabolism
sko00591  Linoleic acid metabolism
sko00592  alpha-Linolenic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102806173
   00565 Ether lipid metabolism
    102806173
   00590 Arachidonic acid metabolism
    102806173
   00591 Linoleic acid metabolism
    102806173
   00592 alpha-Linolenic acid metabolism
    102806173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102806173
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102806173
    3.1.1.5  lysophospholipase
     102806173
Membrane trafficking [BR:sko04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102806173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 102806173
NCBI-ProteinID: XP_006820488
Position
Un
AA seq 339 aa AA seqDB search
MAVFLFCALLLRGVQSDEKHSMWTDYMRAIEFLQTRELYKDTTVYKSTTYHDPPSSFPCD
VDIPLNRTDINVHSLRPSDIKVIGAMGDSLTAAYGALAENIIDLVFPLWESEEARGVSFS
VGGDPNPVNGTTVTLPTILMQYESENELVGYSLGRGGINDKGSNLNVAVGGATSYDMPEQ
ALILIERMKSRPEINYYHDWKVVTLFIGGNDLCGSCRNPERFTAQNYINNVRKALDIMHA
EKLTRELVNYGRYDTRDDFTVVVQPFFEDTGLPWNEETQEWDDSIMSPDCFHFSELGHKL
SAGGLWNNMNDVFKTRLNSDPAFYVPPTGYPPITREPET
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcagtctttctgttctgtgcattactattacgcggagtacaatcggatgaaaaacac
agcatgtggacagattatatgcgtgctatcgaattcttacagacgagggaattatacaag
gatactacagtatataaatcgacgacttaccacgatccaccctcatcgttcccatgtgac
gtagatataccattgaacaggacggacattaacgtacattcactgcgtccttctgatatc
aaagtgatcggtgcgatgggagattccttaactgctgcctatggagccctagcagaaaat
atcattgatctagtttttccgctttgggaaagtgaggaggccagaggtgtgtcatttagc
gtcggaggcgatccaaatcccgtcaatggaaccactgtcaccttaccaaccattttaatg
cagtacgaatcggagaatgaattggttggatactctcttggcagagggggtattaatgac
aaaggttcaaatttaaatgtagctgtcggtggagcaacatcctatgatatgccagagcaa
gccctgattttgattgagcgaatgaaatcgcgtcctgagatcaactattaccatgattgg
aaagtggtgacattattcattggtggtaatgatctatgtggttcatgtcgtaatccagag
agatttactgcacagaattatatcaacaacgtacgtaaggccctggatattatgcacgcc
gagaaattgacacgcgagttagtcaactatggacgatatgatacacgtgatgatttcact
gttgttgtgcagccattctttgaagataccggattgccgtggaatgaggagacccaggaa
tgggatgacagtataatgtcccccgactgtttccattttagtgaactcgggcacaaactt
agtgctgggggactgtggaacaatatgaacgacgtctttaaaacgaggttgaacagcgac
ccagcgttctacgtacccccgaccggatatccaccgatcactcgcgaacccgaaacatga

DBGET integrated database retrieval system