KEGG   Saccoglossus kowalevskii (acorn worm): 100371818Help
Entry
100371818         CDS       T04123                                 

Definition
(RefSeq) octopamine receptor 1-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100371818
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sko04030]
    100371818
G protein-coupled receptors [BR:sko04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100371818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100371818
NCBI-ProteinID: XP_002734017
Position
Un
AA seq 327 aa AA seqDB search
MNVTKTFTAWHPENFVNNGSNWTNDERDKYSTLDCDSLMTLFYTELGVLAFLGIPVVIGN
TLVILAVYQNHNLRTPPNYFIVSLAFADLMIGVTMAAQNVLLHGQGVITHKWACVVISVI
AYNPIGASLSHLLAIGIDRYIAILHPLRYHQLITVSRVKVVIVIIWVYCFVTIAPIWFMT
DSKANSCYELMIPIIRGPGIFITIVAFVVPLIIMVAIYARIFVIARHHLRRINPQSEDTQ
QQHYMKREVKAAITPCVVIGVMLFCWVPQFIVVVMDRYEVCANPQRFVSNLFMLINSGAN
PLIYARHNTEFRQAFRKSIQKIKASLC
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaaaaacatttactgcatggcaccccgagaattttgtcaataatggatct
aactggacaaatgatgaacgtgacaaatacagcaccttggactgtgatagtttgatgacg
ttattctacacggagcttggggtgttggcatttctaggtattcccgtcgtgattggaaac
actttagtgatacttgcagtttaccagaatcacaacttacggacacctccaaactacttt
atcgtcagtttggcatttgctgatttgatgattggagtaacaatggctgcccagaatgta
ctattgcatggccagggtgttataactcacaaatgggcatgtgtagttataagtgtaatt
gcatataatcctataggggcatcactttcacatttactagcaatcggaattgacagatac
attgcaattcttcaccctcttcgttatcaccaattgatcaccgtgtcaagagtcaaggta
gtcatcgtcataatatgggtctattgttttgttaccatagctccaatctggttcatgact
gacagtaaagctaatagttgttatgaactaatgataccaattattcgtggaccgggaatt
tttattactatagtagcatttgtcgttccattgatcatcatggttgctatctatgccaga
atatttgtaattgcaagacatcatctgcggagaataaatccgcagtcagaggacactcag
caacaacactatatgaaacgtgaggttaaagcagctataacgccatgtgtcgtaattgga
gtcatgcttttctgttgggttccacagttcattgttgtagtcatggatcgttatgaagtt
tgtgcgaacccacaacgttttgtttcaaatctgtttatgctaattaactctggagctaat
cctcttatttatgcacgacataacaccgagtttcgtcaggcattcagaaaaagcattcag
aaaattaaagcatcattatgttaa

DBGET integrated database retrieval system