KEGG   Saccoglossus kowalevskii (acorn worm): 100372048Help
Entry
100372048         CDS       T04123                                 

Definition
(RefSeq) cardiolipin synthase-like
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100372048
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     100372048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDP-OH_P_transf DUF4337 YtxH
Motif
Other DBs
NCBI-GeneID: 100372048
NCBI-ProteinID: XP_002741310
Position
Un
AA seq 386 aa AA seqDB search
MSVWSVVKNVRFARNSGLLISCITTEHAVPTEFNLPGKCRSFYHTIVSCRSQIEQKGSRA
WPTCLRCPTSNHSRYLRLPSCSCQYRTYYVVSNSERHERSVTNKCPTSRTGSGSLFSSAE
IRCMCTHEQQRRSQCGYQDRKTSTKKTLIKAGKRMKDRYEEVEEKIRLKAEEVEDKVKEL
HTAGQKENIYTIPNLLTTSRIAISPLLGYLVLHEYLWFATCLFGIAGITDLLDGYIARNF
ANQQSVFGSILDPLADKILVGVLTVSLTAVNLIPIPLTFVIVGRDALLLSYSFYLRYTSL
PPPFTLRRYFDVTHATVKLKPLLISKVNTNIQLITVAASLAAPVFGYCDHQYLHALWCLT
AGTTVLSGLTYVFAKDTFKILSKRKQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatggtcagtggtgaagaacgttcgttttgcacgcaattctgggctgcttata
tcatgcattaccactgaacatgccgtaccgacggagttcaacctgccagggaagtgtcgg
tctttttaccatacgatcgtgagttgtagaagtcaaatcgaacagaaggggagtagagca
tggccgacatgcttacgatgcccaacctccaaccactctcgctatctcaggctgccttcg
tgttcttgtcagtatcgcacatactacgtagtgtcaaacagtgaaagacatgaacgttct
gtcacaaacaagtgtcctacaagtagaactgggtcaggtagtttgttctcttctgccgag
attcgatgtatgtgcacacacgaacagcagcgacgttcgcagtgtggataccaggataga
aaaacaagcacgaaaaaaacattaataaaagctggtaaacgaatgaaagataggtatgaa
gaagtggaggaaaaaattcgactaaaagctgaagaagtagaagacaaagtgaaggaatta
catactgctggccagaaagaaaatatctatacaataccaaatctactgacaacaagtcgt
atagctatttcaccattactgggctatctagtccttcacgaatatttatggtttgcaacc
tgtctttttggcattgccggcatcactgacctgcttgatggttatatagcacgtaatttt
gcaaatcaacaatcagtatttggcagtattctggaccccctagctgataagatattagtt
ggtgtcttgacagtgtcactcactgcagtgaatttaattccaattccattgacttttgtg
atagttggtagagatgcattattgctttcctattccttctatctacggtatacgtcattg
ccgccgcctttcacactgagaagatatttcgatgtgacacatgctactgttaaattgaaa
cctctactaatcagtaaagtgaatactaacatccagcttattacagtggcagcatctctt
gcagcaccagtgttcggttactgtgaccatcaatatctgcatgcactctggtgtcttaca
gctgggacaacagttttatcaggactgacttatgtatttgccaaggacacgtttaaaata
ctcagcaaacgaaagcagtag

DBGET integrated database retrieval system