KEGG   Saccoglossus kowalevskii (acorn worm): 100372840Help
Entry
100372840         CDS       T04123                                 

Definition
(RefSeq) ketohexokinase-like
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00051  Fructose and mannose metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100372840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    100372840
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     100372840
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100372840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB YcbB DUF3270
Motif
Other DBs
NCBI-GeneID: 100372840
NCBI-ProteinID: XP_006822189
Position
Un
AA seq 304 aa AA seqDB search
MEAKCVLQVGLTCLDIINVLGHYPEEDTDSRCMEQHCLRGGNAGNSSVVLAQLGLPCEYL
GTLAKHKLSELIMEDLHHYGVITDHCVYHDNCQVPTSCCIVNDASGSRTIMHSNANLPEL
SCEDFEKLDFRRYTWIHFEGRNLKEILKMILKVEEYNNKENTKKDKITISVELEKPKMNL
HELSFHGDVVFFSKDYAKHFGYSTAESALDGLQSKVKQGAILVCAWGEHGAWAMETTTKV
KYHSSTFPPDKVIDTLGAGDTFNAGFIYSLVNKQTISEALTMGCKVAGKKCGQHGFGGIA
EGIV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaatgtgttctgcaagttggattgacttgtttggacattattaacgttcta
ggacattatccagaagaagacacggattccagatgtatggagcagcattgtttacgcggt
ggtaatgcagggaattcatcggttgtattagctcagcttggcttaccatgtgaatatctt
ggcaccctagccaagcataaattgtctgaattgataatggaggatcttcatcattacggg
gttattactgatcactgtgtttatcacgataattgtcaagttcccacctcgtgttgtata
gttaacgatgcaagcggcagtcgaacaataatgcatagcaatgcaaatctaccagaacta
agttgtgaagattttgaaaagctggactttcgtcggtacacctggatacattttgaggga
agaaatttgaaagaaatattgaaaatgatcctgaaagtggaagagtacaataacaaagaa
aatacaaagaaagacaaaattacaatatctgttgaactagaaaaacccaaaatgaatctc
catgaactttcatttcatggcgacgtagtatttttcagtaaagattatgctaagcacttc
ggttactcaacggccgagtcagcgttagatggacttcaatcaaaggtcaaacaaggtgct
attttagtgtgtgcgtggggtgagcacggagcttgggcaatggaaaccactactaaagtc
aaatatcattcatcaacgttcccgcctgacaaagtgattgatacattgggagcgggagac
acgtttaatgctggctttatttactcacttgttaataaacaaactatatcagaggccctg
actatgggctgtaaagtcgctggcaagaagtgtgggcagcatggctttggtggaattgcc
gagggcattgtatag

DBGET integrated database retrieval system