KEGG   Saccoglossus kowalevskii (acorn worm): 100373314Help
Entry
100373314         CDS       T04123                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4-like
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100373314
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100373314
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sko03036]
    100373314
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100373314
Protein kinases [BR:sko01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100373314
Chromosome and associated proteins [BR:sko03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100373314
   Centrosome duplication proteins
    Regulators of centriole replication
     100373314
  Sister chromatid separation proteins
   Polo kinases
    100373314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Plk4_PB1 Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 100373314
NCBI-ProteinID: XP_002734025
Position
Un
AA seq 683 aa AA seqDB search
MAVPSVLGDCIEDYQVLHLLGKGGFACVYRARSLSSGLEVAIKMIDKKMMHAAGMVSRVR
NEVEIHCQLKHPSILELYNCFEDNNYVYLVLEMCHKGELNKYLKSHNKIFSEDKAQHFLR
QIILGLLYLHSHGILHRDLTLANVLLTDHMEPKIADFGLATQLNFPTDKHFTMCGTPNYI
SPEIATRSAHGLESDVWSLGCMLYTFLVGRPPFDSDAVKSTLNKVVLAEYEVPDYVSDEA
KDLIFKMLKKNPNDRITLSGILDHPFMIKSESSKIEDQKTKMNGVQNLKTIDMSVDSGHA
TMATVSTGINVPRQPSRTRPLKAFSQGNLTPVTSESEKPSYFSKATTSDSMSKVNSKQYE
MWPAVKKHSQSSNDNRRTGSCNCSQSGSGNHVQSSCQHHANVSSQDVRRKNNSWLDGDRK
AATQPASGVRGSHSVTQNIYTSTSANDHSYKCKTSHYSEIKENGTGDHRRSHKYNNTGSS
SVLHEQSRNATTNTSSSGYVGSSLETTDNHDNTDEYSSVDVSKYSRGTVNGKENSTYQNC
DRTVKSYSNMYGNETRLPSGVNASETRHPNSVCNENRLPSTSGIKTDHYRYRECKEEGRV
ERQEHSTMTRNSKEQLAEARIEGRHVHTSKHEVREGLHADSNSAKTLKDVISPLKAQRLR
PFRQRTRNAVVSISCLNLTQYRQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccccagcgtcttgggggactgcatcgaggactaccaggttcttcatctgctt
gggaaaggtgggttcgcctgtgtgtacagggcccgttctttgagttcaggacttgaggtg
gctatcaaaatgattgataaaaagatgatgcatgctgcaggcatggtatccagagtacga
aatgaagtggagatccattgccagctcaaacatccttccatattagagctttataactgt
tttgaagacaacaactatgtgtatctggtgcttgagatgtgccacaaaggagaactcaat
aagtatctaaagtcacacaataaaatattctctgaagataaagcacaacattttctacgc
caaataattctgggtttgctgtacttacactcccatggtatattacacagagacttgact
ctggctaatgtgttactgacagaccacatggaaccaaaaattgctgattttggtttagca
acgcaattgaatttccccactgataaacactttaccatgtgtggaactccaaactatatt
tcaccagaaatcgccacaagaagtgcacatggtttagaatctgatgtctggtcattagga
tgtatgctgtacaccttcctagtaggaagacctccttttgattctgatgcagtaaaaagt
acattaaataaagttgtactagcggagtatgaagtaccagattatgtgtcagatgaagcc
aaagacttgattttcaaaatgttgaaaaagaatcctaatgataggataactctctcaggt
atccttgatcatccatttatgataaaatcagaatcttctaaaatagaagatcagaaaact
aaaatgaatggagttcagaatttgaaaacaattgacatgtctgttgacagtggtcatgct
actatggcaaccgtatccactggtatcaatgttcctcgtcagccgtctcgtaccagacca
ctgaaagcttttagtcagggtaatttaacaccagtgacatcagagagtgagaaaccttca
tattttagcaaagcaactacctcagatagtatgagtaaagtgaattctaaacaatatgaa
atgtggcctgcagttaaaaagcattctcaatcatctaatgacaacagaagaacagggtcc
tgtaactgcagtcagagtggttcaggcaatcatgtgcagtcgtcctgtcaacatcatgca
aacgtctcatcacaagatgtcaggaggaaaaataatagttggttggatggtgatagaaaa
gcagcaacacaacctgcctctggtgttcgtggaagccactcagtgacacaaaatatttat
acctcaacttcagcaaatgatcacagttataagtgcaagacgagtcattacagtgaaatt
aaagaaaacggaactggagatcacaggagatcacacaaatacaataacactggcagtagt
agtgtattacatgaacaatcgagaaatgctacaacaaatacgagtagcagcggttacgtt
ggttccagccttgaaactactgacaatcatgacaataccgatgaatatagctctgtagat
gtctcaaaatattcccgtggtactgtcaacggaaaggagaattctacgtatcaaaactgt
gacaggactgtgaaaagctatagtaatatgtatgggaacgaaaccagactccctagtgga
gtgaatgcgagtgaaactagacaccctaactctgtgtgtaatgagaacagactccctagc
acctcaggaataaaaactgatcattatagatatagggaatgtaaagaagaaggtcgagtt
gaaagacaggagcacagtactatgacaaggaatagtaaagagcagcttgcagaggccagg
atagaaggacgtcatgtacacacatctaaacatgaagtaagggaaggattacatgctgat
agtaacagtgccaaaacattaaaagatgtcatatcacctctgaaagcacagcgcttaaga
cctttcaggcaaagaacaagaaatgcagtggtgagtataagctgcttaaatttgacacaa
tacaggcagtaa

DBGET integrated database retrieval system