KEGG   Saccoglossus kowalevskii (acorn worm): 100373364Help
Entry
100373364         CDS       T04123                                 

Definition
(RefSeq) polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00330  Arginine and proline metabolism
sko00410  beta-Alanine metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100373364
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100373364
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     100373364
    1.5.3.16  spermine oxidase
     100373364
    1.5.3.-  
     100373364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 100373364
NCBI-ProteinID: XP_006817167
Position
Un
AA seq 398 aa AA seqDB search
MGKWIIPLCEYVVKAIGKWIIPLCEYVVKAIGKWIIPLCEYVVKAIVVEVGANWIQPNNE
NLNPVVSLAKKYKLKGKPSNWDSIIFRNAEGKNVTREALVVRHQLDKSLDYTHDLALELL
ENNKSDMSIRAALRLAKWNPRTPIDEVLEYLRVDFEYGGIAYVTSLKSTAVVVNDKDLFV
TDQRGYSVLIKKMSNEFMKQGDLRLRYGKVVTAITWTNNSVTVRCQDDSVYTAPFALITF
SIGVLQNDVIKFDFPLPTWKMLEIKQFEMALYTKIFLKFPKNATRFWDEQEFILHAHPRR
GFYPVWQNLEAPGLFDVGTNILMVTVTGEESKRLEGQNDNVIRSEVMNVLRHMYGDNIPD
VEEIMLHRWSRDPLYFGAYSNWPVEVSIGAQKRLQANL
NT seq 1195 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagtggatcattccattgtgtgaatatgtggtgaaggcaataggtaagtggatc
attccattgtgtgaatatgtggtgaaggcaataggtaagtggatcattccattgtgtgaa
tatgtggtgaaggcaatagtggtggaagttggcgccaattggatccagcccaacaacgag
aacctgaatcctgttgttagcctagctaagaagtataaattaaaagggaaaccgtcgaac
tgggatagtattatttttagaaatgcagaagggaagaacgtgaccagggaagcgttggtt
gtaagacaccagcttgacaagtctcttgattacacccacgatctagcgttagaactcctg
gaaaacaataaatctgacatgtctatccgtgctgcgctgagactagctaagtggaaccca
cgtacccctatcgacgaagttctggaatatcttcgtgttgattttgaatacggcggaatt
gcgtacgtaacgtcccttaagtctacagctgtcgtcgtgaacgacaaagatttgtttgtg
accgaccaacgcgggtatagcgtacttatcaaaaaaatgtcaaatgaattcatgaaacaa
ggcgacctccgtttaaggtacggtaaagtggtgacggctattacctggacaaacaacagc
gtcactgtccgttgccaagacgactctgtatacacagctccattcgctctcatcactttc
agcatcggcgtacttcaaaatgacgtcataaagtttgactttccccttcctacctggaag
atgttagaaatcaaacaattcgaaatggcactatacacaaagattttcttgaaatttcca
aagaatgcaacccgattctgggacgaacaagaattcatcttacacgcgcatccaagacga
ggattttaccccgtctggcaaaatcttgaagctcccggcttattcgatgttggcacgaat
atattgatggtgacagtgacaggcgaagaatcgaaaagactggagggacaaaacgataac
gtcattagatcggaagtgatgaatgtgctacgtcatatgtatggtgacaacatcccggat
gtcgaagaaataatgctccatcgatggtcacgtgatcccctgtattttggtgcttacagc
aactggccagttgaagtgtcgattggtgctcaaaaaagactccaggcaaacttag

DBGET integrated database retrieval system