KEGG   Saccoglossus kowalevskii (acorn worm): 100373649Help
Entry
100373649         CDS       T04123                                 

Definition
(RefSeq) ethanolamine-phosphate phospho-lyase-like
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100373649
Enzymes [BR:sko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     100373649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 CBM_14
Motif
Other DBs
NCBI-GeneID: 100373649
NCBI-ProteinID: XP_002730485
Position
Un
AA seq 217 aa AA seqDB search
MMEPLTKEQVINLRKKHYGKSCKLFYKSDPIKIVRAQGQYMYDEKNNRYLDCINNVAHVG
HCHPDVVKAGVEQMKVLNTNSRFLHDNLAMYADKLCSLFPSKLSVCYFTNSGSEANDLAI
RLARQHTKHHDVVTVDHAYHGHLTTLIDISPYKFNAHGGEGKKDWVHVAPSPDVYRGMYR
DDKNAGEKYALEVKKIIDEAHKNGRKVSKHVFIIHGS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacccctgacgaaggaacaagtcatcaatttgagaaaaaaacattacgggaaa
tcatgcaagctcttctacaaatctgaccccatcaagatagtacgagcacagggtcaatat
atgtatgatgaaaaaaacaacagatatctagattgcatcaacaatgtggcacatgttggt
cattgtcatcctgatgtagtgaaggcaggtgtggaacagatgaaagtactcaacacaaac
tcccgttttctccatgataatttggctatgtatgcagacaaattatgctcgctttttcca
tcaaagctgtctgtctgttattttacaaattcaggatctgaggcaaatgatttagctata
agattagcaagacaacatactaaacatcatgatgttgtaacagttgatcatgcatatcat
ggtcacttgactacgctgattgatatcagtccatataagttcaatgctcatggaggagag
ggcaaaaaggactgggttcatgtggcaccaagtccagatgtatatcgtggtatgtacaga
gatgataagaatgccggtgagaaatacgcactagaggtcaaaaagattatagatgaggca
cataaaaatggacgaaaggtcagtaaacatgtattcataattcatggttcttag

DBGET integrated database retrieval system