KEGG   Saccoglossus kowalevskii (acorn worm): 100374431Help
Entry
100374431         CDS       T04123                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00230  Purine metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100374431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100374431
Enzymes [BR:sko01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100374431
Protein kinases [BR:sko01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100374431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Vinculin Smim3
Motif
Other DBs
NCBI-GeneID: 100374431
NCBI-ProteinID: XP_006819915
Position
Un
AA seq 1025 aa AA seqDB search
MAVYQAFSDRLLRCVVWVLANCNPRIGTGMVVDLRYIENVDFFVGAPCSLVAIPTGHLAS
YWNLPFVAWVSRDPKLADKEEFTTSARIMGPLNKVSKLCAQIFNQFGWRLGVMVYSESVD
FCVYATTAVQTSFRANNISLGDTIKLRDQMSSEEMTEAFLKIRQRGRIVIFCTTNLNNER
KFMLFAHEQGMTGGDYVFINLNQLFTDIRTPQNPWEMGDDRDVDAYYAYESVLTLEMATV
SNEEIDEFLDLIPIKMAEPPFNYTLAPGIRGNIYSPFLHDAVFMYAIALNKTLEQGGHPR
DGEKWFSNVKGLTFHGMTGNVVMDENGDREPDYWVLDLRPSGHMEVVAESINGPNGERIF
RMSHLPIWGRNGNGAILKTPSDRPACGFLGEHCNETDNSVLIATVTVAVVVILCGAIAAV
LVYRVRFQSMTTSLWQIKSEEVQVFQRLQATLGSLHSKSSAAEALDQQDKTFTVVGSYQG
IMCAIRYLKIENHNPTNENIEELKTMRNLSHENINKFYGACFEQSHNFLLTAYCPKGSLS
DILNNEDIKLDWMFKISFIADLIEGIAFLHKTILGSHGYLKSTNCVVDKKWVLKITDYGY
CKYRAKAGDYVTGIEDRSASMAFNENSDKIWSQHLWTAPELLRDLNRPVNGTHRGDIYSF
GMILQEIVQRRGPFPTEKYMFYKDIVNRVRSGETPPFRPDISPMLSEPEITDMMHISLSE
VPELRPCCDNIRRRLYQLNNGQKPNVLDNLLQKMEKYADNLEELVNARTQELVDEKKKTD
MLLYRMLPPSVAEQLKSGQQVHPETYDQVSIFFSDIVGFTVISSHSTPMQVVDLLNDLYT
LFDEIIQRFDVYKVETIGDAYMVVSGLPNRNGFRHASEVANMSLVMLREISNFKIPHMPG
DTLQLRIGIHTGPCAAGVVGLSMPRFCLFGDTVNVASRMESTGEALKIHCSKWTYNVLGY
TGGYRWKERGDVEVQGKGKILTYWLLGRDTPYEKSNDQSSSDCKLSPPSHRDTPLGSQNA
DNINH
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatatcaagccttctctgatcggttattaaggtgtgtggtgtgggtacttgct
aattgcaatccacgaattggtacaggcatggttgtagatctaaggtacattgagaacgtc
gacttcttcgttggagcgccctgttccttagttgcaattccgactggacatctcgcttct
tattggaatctcccgtttgttgcatgggtgtcacgtgacccgaagttagccgacaaggag
gagtttacaacttcagcccgaattatgggcccattaaacaaagtcagcaaactatgtgcg
cagatattcaatcaatttggttggaggttgggcgtgatggtttactcggaatcagtggat
ttttgtgtttacgctactactgccgtgcagacgtcattccgagcaaacaacatcagcctc
ggagacaccattaaattacgggaccagatgtcatcagaagaaatgacagaggctttcttg
aagattcgacagcgcggcagaattgtaatattctgcactaccaacttgaataacgaaaga
aaatttatgctgtttgcgcatgagcagggaatgacaggtggcgactacgtatttatcaat
ctcaatcaattattcactgatattcggactccacaaaatccatgggagatgggagacgat
cgagacgttgatgcctattacgcctacgagtcggtgctcacgctggaaatggcgacggtc
agcaacgaagaaatagacgaatttcttgatctcattccaattaagatggcagagcctcca
tttaattatacacttgcacctggtatacgaggtaatatttattcaccgttcttgcatgat
gccgtattcatgtacgcaattgctttgaataagacactggaacagggtggtcatccaaga
gatggtgagaaatggttcagtaacgtcaaaggactcacatttcatggtatgactggcaat
gtagtcatggacgaaaacggagaccgggagcccgattattgggttcttgatcttcgaccg
tctgggcacatggaagtagtcgcagaatccattaatggaccgaatggagagcggatattt
cgaatgtctcatttacccatttggggaagaaatggcaacggggcaattctaaaaacgcca
tccgaccgtccagcttgtggattccttggagaacactgtaatgaaactgacaactcagtc
ttaatagccacagtgacagtagcagtggttgtaatactatgtggcgctatagcagccgtg
ctagtttacagagtgcgtttccaaagcatgacgacatctctttggcaaattaaatcagaa
gaagtgcaggtatttcaaaggctgcaagctacattagggagtcttcactcaaagtcgtct
gcagcagaagcattggatcaacaagacaaaacttttaccgtagtcggatcgtatcaagga
attatgtgcgctattcgctacctgaaaattgagaaccacaatccaacaaacgaaaacatt
gaagagttaaaaacgatgagaaatttgagtcatgagaatatcaacaaattttacggagca
tgttttgagcagtcgcataatttcttgctaaccgcatactgtccgaaaggaagtttgtct
gatattttgaataatgaagatatcaagctggactggatgttcaagatatcatttatcgct
gatctcattgagggcatagcctttcttcacaagacaatacttggttctcatggttactta
aaatctaccaactgcgtggtggacaagaaatgggttttaaagatcactgactatggatat
tgtaaatacagagcaaaggctggtgattacgtcactggaatcgaagatcgttcggctagt
atggcattcaatgaaaactctgataaaatatggtcacaacatctgtggacagccccagag
cttctacgtgatcttaaccgacctgtgaatggaactcatagaggagatatatacagcttt
ggaatgatcttacaagaaattgtacaacggcgtggaccgtttccaactgaaaagtatatg
ttttataaagatattgtgaatcgtgtcagaagtggagaaacacctccatttcgccctgat
atatctcccatgttgtctgaaccagaaataactgatatgatgcatatcagtctatctgaa
gtacccgagttacgaccatgttgtgacaatattcgacgtcgtttgtatcaattaaacaat
ggacaaaagccaaacgtactggataacttgcttcagaaaatggaaaaatatgctgataac
ctagaagaactcgtgaatgcgcgcacacaggagctggttgacgaaaaaaagaaaacagac
atgcttctctacagaatgttacctccaagcgttgcagagcagttgaagtcaggccagcaa
gtacacccagagacgtacgaccaagtatccatatttttttcggatatcgttggattcact
gtcatttcatcacacagtacacccatgcaagtagtggacctactaaacgacctatatacg
ctatttgatgagattatacaacgctttgacgtgtacaaggttgagactattggggatgct
tatatggttgtctctggattaccaaatcgcaacgggttccgtcacgcgtctgaggttgct
aatatgtcattggtcatgcttcgggaaatcagtaattttaagataccgcacatgccaggg
gacactttacagctgcgtatcggaatacatactggcccatgtgcagctggagtggtaggt
ctgtctatgccacgcttttgtctctttggcgacactgtaaacgtagcatctcgaatggaa
tccacaggagaggctctgaaaatacactgcagtaaatggacgtacaatgttctcggatat
actggtggatatagatggaaggaacgtggggatgttgaagttcagggaaagggcaaaata
ctaacatactggctgttgggaagagacaccccatatgaaaaatcaaacgaccagtccagt
agcgactgcaaattatcgccaccttcgcatcgggacacacctctcggatcacagaacgca
gataatattaaccattga

DBGET integrated database retrieval system