KEGG   Saccoglossus kowalevskii (acorn worm): 100375151Help
Entry
100375151         CDS       T04123                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00450  Selenocompound metabolism
sko00970  Aminoacyl-tRNA biosynthesis
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100375151
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100375151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sko01007]
    100375151
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sko03016]
    100375151
Enzymes [BR:sko01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100375151
Amino acid related enzymes [BR:sko01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100375151
Transfer RNA biogenesis [BR:sko03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100375151
 Prokaryotic type
   Other AARSs
    100375151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_5 tRNA-synt_1g GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 100375151
NCBI-ProteinID: XP_002741176
Position
Un
AA seq 266 aa AA seqDB search
RIVPYLARNKLPVLELNSGDFIFSANIITRYLLCKAGKDSDDIEVDEWIEWEASQLQAIL
QPYLVGMASKSKCDVGLVTGILNYLNSSLKGSGYLVKDTLSAADIIVWSSLYPLFAENTT
LQSQHASVNKWFQELLKQQMFQSAVTMVTQGKGVKMFYDSIAMQPVTSPSVVHHKKLQSK
GIVSEDTEVQSNEKCTVASPSEVAMATDAWYNGCKSAPLPYRPSHPIYPVENKENILITS
ALPYVNNVPHLGNIIGCVLSADAFAR
NT seq 803 nt NT seq  +upstreamnt  +downstreamnt
cacgcattgttccgtatttagcaaggaataaactacctgtacttgaactgaactctgggg
acttcatcttctcagcaaacataatcacaaggtatttgttatgtaaagctggcaaagatt
ctgatgatatagaagtagatgaatggatagaatgggaagcctctcaattacaggctatat
tgcagccttatttagttggcatggcaagtaaatccaaatgtgatgttggcttggtaactg
gaattttaaattacttaaattcatctttgaaaggcagtggatatctggtgaaggatacac
tgtctgctgctgacatcattgtctggtcttcactctatcccctatttgctgaaaatacaa
cacttcaatcccagcatgcatcagtcaataagtggttccaagaattactcaaacagcaaa
tgtttcaatcagctgttactatggtaacccaggggaaaggtgtcaagatgttttatgact
ccatagcaatgcaacctgtaacaagtccatcagtggttcatcataaaaaactacaatcaa
aaggaatagtcagtgaagacacagaggttcaatcaaatgagaaatgtactgtggctagtc
catcagaggttgctatggcaacagatgcatggtataatggctgcaagtcagctccattgc
cgtatagacccagccatccaatatatccagttgaaaataaagaaaatattcttatcacaa
gtgcattgccttatgtcaataatgtaccacatcttggtaatattataggatgtgtcctca
gtgctgatgcatttgcaaggtga

DBGET integrated database retrieval system