KEGG   Saccoglossus kowalevskii (acorn worm): 100376334Help
Entry
100376334         CDS       T04123                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00010  Glycolysis / Gluconeogenesis
sko00562  Inositol phosphate metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100376334
   00562 Inositol phosphate metabolism
    100376334
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100376334
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100376334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100376334
NCBI-ProteinID: XP_002738932
Position
Un
AA seq 468 aa AA seqDB search
MEIDVVSRTTLLFVFMVVVNLSDSQNYSEFIGDLLTTKTTYEASFGGLEKMSAALNATRT
HLQMVAESCVALQVNALIRHGVRYPGKQFYGNISQLIDLQEQIESEEFFHLKAQTNPFLD
VTEAQQLAENGRQELRNLGIRYANYFSELFLDGTAQNFTEKCVFISSDLPRTRDSAKAFI
LGMQSIVGNDKDDELKMMMEDQIEILDIATDFMLRFYYNCEKVVQTVQRNKTALAEYYLF
GDGSEINSVVDGVSKRLKIKHSRLTNEHVQMLYTLCSTTLAIFNEISWCEVFTQDELRVM
EYWSDVKQYWKKSYGHKINYHISCQFLQHIFSTLEDNHDNSPVGVFRFGHAETLIPLLSI
LGLYKDEEIILKYDNYHSNWNRTFRASKLSPFAGNIAFVLYSCTDSTGNSTYMIEVLLHE
QPVTLPCCASTLCSYDVIKQFYSTWLEDCDLTELCGTWTEIRQPREEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgatgtagttagccgaactaccttactgttcgtattcatggtggtagtcaac
ttatcagattctcaaaactatagcgaattcattggcgatctgctcacaacgaagacgacg
tacgaagcatcgtttggtggtttggaaaaaatgtcagccgcactgaatgctacgagaact
cacctgcaaatggtcgccgaatcgtgtgttgctctgcaagtcaacgctttgataaggcac
ggtgtacgatatcccggtaaacaattctacggtaacataagtcagcttatagatctccag
gaacaaattgaatcggaagaattcttccacttgaaagctcagacaaacccattcctagat
gtcaccgaagctcaacagctagctgaaaacgggaggcaagaactccgcaaccttggaata
agatatgcaaattacttttctgaactgtttctagatggcactgcgcagaatttcactgag
aaatgtgtttttataagctctgacttgcctcggactagagacagtgccaaggcattcata
cttggtatgcaaagcattgtgggaaatgataaggatgatgagttgaaaatgatgatggag
gatcagatagagattcttgacattgcaacagattttatgctgaggttttattataattgt
gagaaagttgtccaaacagtgcagagaaacaagacggcattggcagagtattatttattt
ggtgatggatcagagataaattctgtagtggatggagtttcgaagaggttaaaaataaag
cactcaagacttacgaatgaacatgtgcaaatgctgtatacattgtgctcaaccacgttg
gcgatattcaacgaaataagttggtgtgaggttttcacgcaagatgaactgagggtcatg
gagtattggtcagatgtcaagcagtactggaagaaaagctatggtcataagattaattat
catatcagttgtcaatttttacaacatatttttagtacgctggaagataaccatgacaac
tctcctgtgggtgtatttcgttttggacatgctgaaaccttaataccgttattaagtatt
cttgggttgtacaaagatgaagagattatcttgaaatatgacaattaccatagcaactgg
aacagaactttccgagccagcaagctgtctccgtttgctggtaacatagcctttgtttta
tacagctgtacagatagcactggaaactcaacgtatatgatagaggtattactccatgaa
cagccagtgactttaccatgctgtgcttcaacattgtgctcctatgatgttattaaacaa
ttttattccacatggctggaggattgtgatttaaccgaattatgtggaacttggactgag
atacgccaaccaagagaagagctctga

DBGET integrated database retrieval system