KEGG   Saccoglossus kowalevskii (acorn worm): 100376918Help
Entry
100376918         CDS       T04123                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00511  Other glycan degradation
sko00600  Sphingolipid metabolism
sko01100  Metabolic pathways
sko04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100376918
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100376918
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100376918
Enzymes [BR:sko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100376918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 100376918
NCBI-ProteinID: XP_006814202
Position
Un
AA seq 418 aa AA seqDB search
MTGDRLTRRVYNIDIKPNISNTDITFTINSTHTYQQILGFGGAFTDAAGINILNLTKDVQ
DRLLESYYSPNGIEYTLGRIPMASCDFSTHPYSYDDVVGDFSLENFALTKEDLSFKIPII
QRALNMSQNILNIFFFRFVEEYSKNGIQLWGLTAQNEPTDGAIEGFSFQAMYFNETSQRD
FIKLDLGPTLKARGHKDVKLMILDDNRIMLPRWAETVLQDPDAAQYVSGIAVHWYLNSFI
PANILSITHDKCPDYFILSTEACAGSFPLTKPVMLGNWERGESYSHDVITDLQNWVTGWV
DWNIALNMQGGPNWVENFVDSPVIVDAENDVFYKQPMYYHLGHFSKFVEPGSMRVDVKSD
KTNDLLIVAFITNKKRITVVILNSENKAVKIHLYDIKSGYINAEVPARSIQTYTWMTK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtgatagactgacaaggagagtttacaacattgatatcaaaccaaacatttca
aatactgatataacatttaccatcaattcaacacacacatatcaacagatattaggattt
ggtggagccttcactgatgctgctggtattaatattctaaatttgactaaagatgttcaa
gacagattattggaatcctactactcaccaaatgggattgaatatacattaggtcgtata
ccaatggcaagttgtgatttctcaactcatccttattcatatgatgatgtagtgggggac
ttctctttggaaaattttgcattaactaaagaagatttgtcatttaaaattccaattatt
cagagagctctcaacatgagtcaaaatatattaaatattttttttttcagatttgttgaa
gaatattccaagaatggaattcagttatggggtttgacagctcaaaatgaacccacagat
ggtgctattgaaggattttcatttcaagcaatgtatttcaatgaaacatcccaaagagac
tttatcaagcttgacttaggtccaaccttaaaagctaggggacacaaggatgtgaaatta
atgatactggatgataacagaatcatgttgccaagatgggctgaaacggtgttgcaagac
ccagacgctgcacagtatgtctctggtattgctgttcattggtatttgaattccttcata
ccagcaaacattctatcaatcacacatgataaatgtcctgattattttatactgtctact
gaagcctgtgcagggtcattccctctaaccaagcctgtcatgcttggaaactgggaacga
ggtgaatcatacagtcatgatgttataacagatttacagaattgggtcactggttgggta
gattggaacatcgctttaaatatgcaaggtggtccaaattgggtagaaaattttgttgac
agtcctgtaatagttgatgctgaaaatgatgtcttctacaaacaaccaatgtattatcat
ttaggtcatttcagtaaattcgtagaacctggctctatgagggtggatgttaaaagtgat
aagacaaatgacttattaattgtagcatttatcaccaataagaagagaataacagttgtc
attctgaacagtgaaaataaagctgtcaagattcatttatatgacataaaatctggttac
atcaatgctgaggttccagccagatccattcagacatatacttggatgacaaagtaa

DBGET integrated database retrieval system