KEGG   Saccoglossus kowalevskii (acorn worm): 100378736Help
Entry
100378736         CDS       T04123                                 

Definition
(RefSeq) activin receptor type-2A-like
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100378736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100378736
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100378736
Protein kinases [BR:sko01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100378736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100378736
NCBI-ProteinID: XP_006822061
Position
Un
AA seq 526 aa AA seqDB search
MMLDYLLKVTLITILPIVYSGILVDSQENTWCKYYNTEDCDKDQHGCNASQQCEYDRIGP
SEHCFSLWGNNSGVIELKKQGCWINSGDGQCGESARCAGSVDENDLYFCCCRGHMCNVDF
YYEEREEVTTTTIVTVSGPIVYQHGSLFNTIMYSLLPIMGLALVISVAYWIYSHHKETTH
IQIPLQDPSPLPSPSPLLGMRPLKLLEVKARGRFGAVWKAQMLNEVVAVKIFPLQDKASW
LNEQEIFNLPYMLNNNHVLNYIAAETRGENINQEFWLVMEFHPHGSLCDYLKANLITWSE
LCKIGQTMAQGLSFLHEDIPATKDSRNKPAIAHRDFKSKNVLVQNDLSVCIADFGLAVKF
EPGQSPGEAHPQVGTRRYMAPEVLEGAINFQRDSFLRIDMYACGLVLWELASRCTAADGP
VDEYMLPFEEEVGQGPTLELIQDVVVHKKMRPQFREHWQKNPGLEALCSTIEECWDHDAE
ARLSAGCVEERISQLRRACDVSTSTLQSVTSSNQPLLPKEAKESSL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggactaccttttaaaagtcactttgataacaattcttccgatagtttattca
ggtattcttgtcgacagtcaagagaatacatggtgtaaatattacaatacagaagactgt
gacaaagaccaacatggatgtaacgcatcacagcaatgtgaatatgatcgtattggtccc
tctgaacattgcttttcgttgtgggggaataattctggtgtaatcgagttaaaaaaacag
ggatgttggatcaacagtggtgatggtcaatgtggcgagtccgcaagatgtgccggaagc
gtggacgagaacgacctttatttttgttgttgtcgtggtcatatgtgtaatgtcgacttt
tactatgaagagagagaagaggtcacaaccacaacgatagtgactgtatctggtcctatc
gtataccaacatggcagtctatttaacacaataatgtactcgttgctgcctataatggga
ctagcgttggtgatttcggtggcatactggatatacagccatcataaagaaacgacacac
atacagatcccattgcaagatcccagtcctttaccgtcgccatcgccgcttttaggaatg
cggccgctgaaacttctagaagtaaaagcaagaggtcgatttggagccgtctggaaagct
cagatgttgaatgaagtcgtcgctgttaaaatcttcccattgcaagataaagcatcgtgg
ttaaatgagcaggagatcttcaatttaccgtatatgctcaacaacaatcatgtactgaat
tatatcgccgcggaaacccgtggagaaaatataaatcaggaattctggttggtgatggag
ttccatccacacgggtcattgtgtgattacctgaaggctaatctaattacatggagtgaa
ctttgtaaaataggacaaacaatggcacaaggcctgtcttttctccatgaggatatccca
gcaacaaaagacagtagaaataaaccagccatagcacacagggattttaaaagtaaaaat
gtactcgtacagaacgatttatcagtgtgtattgctgactttggtttagctgttaaattt
gaaccaggtcagagtccaggggaagcacatccacaggtgggcacaaggaggtatatggct
ccagaagttttagaaggggcgattaattttcaacgagattcgttcttgcgtattgacatg
tatgcatgtggattggtactctgggagttagcgagtaggtgtactgctgctgatggtcct
gtggatgaatacatgttaccgtttgaagaagaggttggacaaggtcctacactggaactc
atacaagatgtggtagttcataaaaagatgaggcctcagttcagggaacattggcaaaaa
aatccgggtttggaagccttatgttcgacaattgaagagtgttgggatcacgatgcagaa
gccagactatctgctggatgtgttgaagaaagaatatctcagttaagacgtgcttgtgat
gtatctacctcgacgctacaatctgtgacgtcatcaaatcaacctctactcccaaaagaa
gccaaggaatcaagtctgtga

DBGET integrated database retrieval system