KEGG   Saccoglossus kowalevskii (acorn worm): 102800467Help
Entry
102800467         CDS       T04123                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00480  Glutathione metabolism
sko00590  Arachidonic acid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102800467
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102800467
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102800467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102800467
NCBI-ProteinID: XP_006825262
Position
Un
AA seq 219 aa AA seqDB search
MLFRLGAFVLLTLVAVTHGTKKYCEIVDPAKTFHSYGAVSLHTGEPVTFDQYIGWTLLVI
PVATYDDLNHQYLEFNQLQTEFLSQNFTILAYPTTEFWKKEPGSNDEILNGLREVRPGGG
YVPNFEIFEKVNVNGATQTDAWAYIKGNCHSPVDELGDSKYLFWEPFNNRDVRWTFLERI
IIGADGLPYIRYNDPSDPYTPGGLRDDIEQYLRDGYIDL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcgattgggagcctttgttctcctaacacttgtagctgttacacatgggact
aaaaaatactgcgaaatagtggaccctgccaagacttttcactcttatggcgcagttagt
cttcatacaggtgaaccggttacgttcgaccagtatattggctggaccctgttggtaatt
cctgttgcaacgtacgatgatttaaaccaccagtacctcgaatttaatcaactacaaact
gagtttttatcacaaaacttcaccatattagcttatccaacgaccgagttctggaaaaag
gagcctggtagcaatgatgagattttgaacgggttaagagaagtaaggcctggtgggggt
tatgtgcccaactttgaaatatttgaaaaggtcaatgtcaatggagccacacagacagac
gcatgggcatatattaagggtaactgtcactcccctgtggatgagcttggcgacagcaaa
tatttattttgggaaccgttcaacaaccgagacgttcgatggactttcctggagcgcatt
ataattggtgctgatggtcttccatatatacgttacaatgaccccagtgatccatacact
ccaggcggcttgcgtgatgatatcgagcaatatctgagggatggttacattgatttgtaa

DBGET integrated database retrieval system