KEGG   Saccoglossus kowalevskii (acorn worm): 102801665Help
Entry
102801665         CDS       T04123                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00340  Histidine metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102801665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    102801665
Enzymes [BR:sko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     102801665
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102801665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 102801665
NCBI-ProteinID: XP_006814693
Position
Un
AA seq 290 aa AA seqDB search
MSYKTSIYEDVNYYFKCFNIFLAKAKCEGADMWNRQWAGLLAQFQFNADEEIRMLTIGAG
AGYRECLIIQHLLKRHSSIHITVVEPAQKPIDEFKIKAAKITKEFPGVSFEWHIQTFENY
QKDHRVSDDVRDGSFHLVFAGHSLYYMDDWQYALDGMYSHVQSGGILVVTVIRGQAGAGR
LAKMYRKLEGCSLNLQTSDDVKHQLKKTNSEQMIDQNMYREDAYDISDVFDESSVVGNLL
LDFLIQRRDFRMSAPHGHLEKVLQFLRENSVQENGKYWFYSDEEDVVAKK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacaaaacaagcatttacgaagatgtcaactattatttcaaatgcttcaacata
tttttggcgaaagcaaagtgtgaaggtgctgatatgtggaataggcaatgggcaggactt
ctagcacaatttcaattcaacgccgatgaagaaatacgaatgctaacaatcggagctggt
gcaggttacagagagtgtctgataatccaacatctgttaaagagacatagtagtatacat
atcaccgtggtcgaacctgcacagaaaccgattgatgagtttaagataaaagcggcaaag
atcacaaaggaatttcccggtgtgagttttgagtggcacattcaaacgtttgaaaactat
caaaaggaccacagagtatcagacgatgtacgcgatgggtcatttcatcttgtgttcgct
ggacatagtttgtattacatggacgactggcaatatgcattggatgggatgtacagtcac
gttcaatcaggagggatattggtggttacagtaataagggggcaagctggggctgggaga
ctcgcgaagatgtatagaaagttggaaggttgcagtttaaacttacagacgtccgatgat
gttaaacaccaactaaagaagaccaactctgagcagatgattgaccaaaacatgtatcgt
gaagatgcttatgatatatctgacgtgtttgacgaatcttctgtagttggaaatttgttg
cttgattttcttattcaaagacgggattttagaatgtctgccccacatggtcatctagaa
aaggtgttacagtttttaagagaaaactcggtacaagaaaatggaaaatattggttctat
tctgatgaagaagatgtggtcgcgaaaaaatga

DBGET integrated database retrieval system