KEGG   Saccoglossus kowalevskii (acorn worm): 102802148Help
Entry
102802148         CDS       T04123                                 

Definition
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial-like
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102802148
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     102802148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLDc_2 PLDc
Motif
Other DBs
NCBI-GeneID: 102802148
NCBI-ProteinID: XP_006816893
Position
Un
AA seq 439 aa AA seqDB search
MSGTKPRNKQKNPNFSPQLTISSKVVSMGNMAGACLRLLQGLFRKEAITRASIGVRQYHQ
QSSLGENMDPVFQEFSWISRFAPVFAVNGDQVTILREPSEFYKTLKEKARHARNRIVLAS
LYLGTGELEQQLVDSIHEAAKNSTHSLHIQILLEYTRGSRGKHNSRTMLLPLLREYGSNV
NISLYHSPDLRGMLKRFVPARLNEAIGLHHMKIYLFDDSLIISGANLENQYFTNRQDRYI
LLEDCPQVANFFTQLVSTVSGFSFQLHEDDSVSMKEDFGIHPFTGDIKMFKQEAERRVRS
LLDAHQQFTKLTTTKLHNVSNIETVNKTNILPELRTRKVAGNAGSVCIDDIEERTIKKQE
TIHSTDSSNKLDTLIYPLIQMGPLGITNDEEATMYLLENSPCGSRIHLASGYFNLTESYI
DIVLNKSKAFFNILSAAPQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaaccaagccaagaaataaacaaaagaatcccaacttttcaccgcagttaact
ataagttcaaaggttgtcagtatgggaaacatggccggtgcgtgtcttcgtctgcttcaa
ggattatttcgcaaagaagcaatcaccagagcaagcattggtgttaggcagtatcatcag
cagtctagtcttggtgaaaacatggatcctgtgttccaagaatttagttggatttcacgt
tttgctcccgtgtttgctgtcaatggagatcaagtaaccattctgagagaaccaagtgaa
ttttataaaactttaaaggaaaaagctcggcatgcaagaaatagaattgtgttagcatct
ctgtacctgggtactggtgaattggaacaacaactggttgatagcattcatgaagcagca
aagaattcaacccattcactacatatacagattttattggagtacactagggggtccaga
ggaaaacataattccaggacaatgctgttaccattacttcgtgaatatggttctaatgtg
aacatatctctgtatcatagtcctgatctgaggggcatgttaaaacgctttgtaccagca
aggttgaatgaagctattggactacaccatatgaaaatatatttatttgacgattcactg
attattagcggtgccaacttagaaaatcaatactttacaaacagacaagaccggtacatc
ttacttgaagactgccctcaagtggcaaactttttcacccagctcgtttccacagttagt
ggtttttcatttcaacttcatgaggatgacagcgtcagtatgaaagaagattttggtatt
catccattcaccggtgatatcaaaatgttcaaacaagaagcagaaagaagagtcaggtca
ctactggatgctcatcaacagtttacaaaattaacaacaaccaaattacacaatgtttca
aatattgaaactgtgaataaaaccaacattcttcctgaattgagaactcgaaaagttgct
ggaaatgctggaagcgtttgcattgatgatattgaagaaaggactatcaaaaagcaggag
actattcacagtacagactctagcaataagctggatacgttgatttatccgttaatacaa
atgggaccattaggaatcacaaacgatgaggaagcaacaatgtatttactagaaaactca
ccatgtggaagtcgcatacacttagcatcaggatattttaacttaacagaaagctacatt
gatattgtattaaataaatccaaagcattctttaacatattaagcgctgcacctcag

DBGET integrated database retrieval system