KEGG   Saccoglossus kowalevskii (acorn worm): 102802832Help
Entry
102802832         CDS       T04123                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase-like
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00513  Various types of N-glycan biosynthesis
sko00514  Other types of O-glycan biosynthesis
sko00515  Mannose type O-glycan biosynthesis
sko00533  Glycosaminoglycan biosynthesis - keratan sulfate
sko00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    102802832
   00515 Mannose type O-glycan biosynthesis
    102802832
   00514 Other types of O-glycan biosynthesis
    102802832
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    102802832
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    102802832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sko01003]
    102802832
Enzymes [BR:sko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     102802832
Glycosyltransferases [BR:sko01003]
 Terminal extension
  Sialyltransferase
   102802832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 102802832
NCBI-ProteinID: XP_006822304
Position
Un
AA seq 188 aa AA seqDB search
MNVSPVKGYEKDVGTKTTIRITYPEGAPRKNNLYDVDALLGIVVFKLADLNWLDSVLHRK
TPSTKGFWSKIAMSVPKNPRQTRIINPLIIREASFDLLGYPTNLGKMNKNVPTSGTISIM
LALRLCDEVDVVGFGYNTKEPEALIHYYEKVKMKIITSLFTHDINHETAFLKKLVEFGVI
RDLTGGLS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtttcacctgtcaaaggttacgaaaaagatgttggcactaaaacaactatcaga
atcacatatccagaaggtgctccacgtaaaaacaatttatatgatgtagatgccttatta
ggaattgtagtgttcaaacttgctgatctcaactggttagacagtgttttacatagaaaa
acaccatcgactaaaggtttttggagcaagattgcgatgagtgttccaaagaaccctcgt
caaactcgtatcatcaacccgcttatcataagagaagccagctttgatcttcttggatac
cccaccaatcttgggaaaatgaacaagaatgtaccaaccagtggaaccatatcaattatg
ctggcactgcgtttatgtgacgaggtggacgtcgttggatttggttataatacaaaagaa
ccagaggctttaatacattattatgaaaaagtgaaaatgaaaatcatcacatcacttttt
actcatgatattaatcatgaaactgcttttctgaaaaaattggttgagtttggtgtgatc
agggatttaactggtggtttgtcgtga

DBGET integrated database retrieval system