KEGG   Saccoglossus kowalevskii (acorn worm): 102802847Help
Entry
102802847         CDS       T04123                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase-like
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00900  Terpenoid backbone biosynthesis
sko01100  Metabolic pathways
Module
sko_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102802847
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sko01006]
    102802847
Enzymes [BR:sko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     102802847
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     102802847
Prenyltransferases [BR:sko01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   102802847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 102802847
NCBI-ProteinID: XP_006824578
Position
Un
AA seq 185 aa AA seqDB search
MAHIKMEERNDAKRFGEMFQELVREIVEPDLEDDEIGDAMKRFKHVLEYNVPGGKRNRGL
TVLSSYKSLKDKSSLDDEEMKCAMVLGWCIEWLQAYFLVSDDMMDGSITRRGQPCWYKKP
GIGLDAINDSFFIEVCIYKMLKKTIRNKPYYISVVELFHEIDKVIQVGGALLAHLLQICT
VRQGG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcacacatcaagatggaggagagaaatgatgccaaaagatttggtgagatgtttcaa
gagttggtgcgtgaaatcgtggaaccagatctggaagatgatgaaataggagacgcaatg
aaacgatttaaacatgtgttagagtacaatgtaccaggtggtaaacgaaacagaggactc
actgtattgagttcatataagtctctgaaagacaaatcaagtcttgacgatgaggaaatg
aaatgtgctatggttttaggttggtgtattgagtggctacaagcatattttctagtgtct
gatgatatgatggatggttctattacaaggagaggacagccatgctggtataaaaagcct
ggaattggactggatgctattaatgactcattctttattgaagtatgtatttataaaatg
ttgaaaaaaacaattcggaataagccatattatatcagcgttgttgaactatttcatgaa
attgataaagttatacaagtgggcggagcactccttgcacacctcctgcagatttgtaca
gttaggcaaggaggctaa

DBGET integrated database retrieval system