KEGG   Saccoglossus kowalevskii (acorn worm): 102803327Help
Entry
102803327         CDS       T04123                                 

Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase-like
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sko03016]
    102803327
Enzymes [BR:sko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     102803327
Transfer RNA biogenesis [BR:sko03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    102803327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 102803327
NCBI-ProteinID: XP_006824582
Position
Un
AA seq 397 aa AA seqDB search
MRICIRTVKFIFRFLHHSQQPTIVYRSLTIDTMPRSIKQKLGHKKKWKPKGSGRIGYEEI
TRANAAFESYYKAQGIVPEGEWDQFMTTLKTNLPATFRITGFRRHAKQLLTFLKSHYFNE
LVNVEVDGLSVAKPYPLPWYPDELAWQLNLSRGNIRKIAALERLHSFLVTETESGNISRQ
ECVSMIPPLLLDVQPQHKVFDMCAAPGSKTAQLIEMLHADENQTWPAPLIVIFICSAPPK
KRPRFDGYKEDPFVFFTKDEEVWSSIREFYRVSSTFPHTQLLTRCETGRKNNLYLVNKVI
KDIISNNEDKVKVINSGIRVLARSDSSDVPCPFRLGQEGSIVMKPFLENRLVRLTKKDVV
ILLTEENPFIHKLSFDAIQEINAHGQGSLMFIYEPGE
NT seq 1193 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatgcattcgtactgtgaagttcatttttcgtttcttacatcattcacagcaa
ccaaccattgtctatagatccttgacaatcgacacaatgccaagaagcatcaaacagaaa
ctgggccacaaaaagaaatggaagccgaaaggaagtggtaggataggttatgaagaaatc
accagagctaatgctgcatttgaaagttattacaaggctcagggtattgttccagaagga
gaatgggaccagtttatgacaactttaaaaactaatttaccagctacatttagaataaca
ggttttagaagacatgccaagcaactgttgacatttttaaagagtcactacttcaatgag
ttggtgaatgttgaggtggatggattaagtgttgcaaaaccatacccattaccatggtat
cctgatgaacttgcttggcaactgaacctttcccgcggcaatatcagaaaaatagcagct
ttagaaagattacatagcttcttagtcacagagacagaaagtggtaatattagcagacag
gaatgtgtcagcatgataccaccattactattagatgttcaaccacaacataaggtattt
gatatgtgtgctgctcctgggtctaaaacagcccaactcatagaaatgttacacgcagat
gaaaaccaaacatggccagcacccctaatagtaatatttatttgcagtgctcctcccaag
aaacgaccacgttttgatggatacaaagaagatccatttgtgttttttaccaaggatgaa
gaggtctggtcttccatacgtgagttctaccgtgtttcatcaacatttcctcacacccag
ctgttaacaagatgtgagactggtagaaagaacaatctgtatcttgtaaacaaagtaatc
aaagacattattagcaataatgaagataaagtcaaggttatcaatagtggtattagagtg
ctggctagaagtgattcatctgatgttccatgcccattcaggttgggtcaagagggatcc
atagtgatgaaaccttttcttgaaaacagactggtgaggctaacaaagaaagatgttgtc
atactactcacagaagaaaatccatttatacataaattgtcatttgatgcaatacaagaa
atcaacgcccatggtcaaggcagtcttatgttcatctatgagccaggtgaaag

DBGET integrated database retrieval system