KEGG   Saccoglossus kowalevskii (acorn worm): 102803922Help
Entry
102803922         CDS       T04123                                 

Definition
(RefSeq) dihydrofolate reductase-like
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00670  One carbon pool by folate
sko00790  Folate biosynthesis
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102803922
   00670 One carbon pool by folate
    102803922
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     102803922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 102803922
NCBI-ProteinID: XP_006815969
Position
Un
AA seq 166 aa AA seqDB search
MKKISLVAAACNNMGIGKNGDLPWRLRKEMSFFTKVTSETKEDGKQNAVVMGRKTWFSIP
EKYRPLAGRYNVILSKNLKECPSGADMLSESLDDAIKQLSEPPLESLESAACYRIYLTRV
MADFDCDTFFPEFDTNLFNLVSDPDVPSEIQEEKGIQFKYEVYEKK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattagtcttgttgccgctgcatgtaacaacatggggatcggaaagaacggg
gaccttccatggcgactacgtaaagaaatgagttttttcaccaaagtgacatcggaaact
aaggaagatggaaaacaaaatgctgttgttatgggccggaagacttggttctcaatccca
gaaaagtaccgaccattagctggcagatataacgtaattttaagcaaaaacttgaaagaa
tgtccatcaggagccgatatgttgtcagaatcactggatgatgcaatcaagcaattgtca
gaaccccctctagaatctctggaatcagcggcatgttatcgtatttacctcactagggta
atggccgactttgactgcgatacattcttcccagaatttgacacaaatttattcaatctt
gtcagtgacccggatgtaccaagcgaaatccaagaagagaaaggaattcagttcaagtat
gaagtttatgaaaaaaagtag

DBGET integrated database retrieval system