KEGG   Saccoglossus kowalevskii (acorn worm): 102805849Help
Entry
102805849         CDS       T04123                                 

Definition
(RefSeq) probable proline dehydrogenase 2-like
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00330  Arginine and proline metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102805849
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     102805849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 102805849
NCBI-ProteinID: XP_006818451
Position
Un
AA seq 535 aa AA seqDB search
MSGRYVVPLCTRLCQAHIHGRNGLITQSFRRRRTDGQRRRHNHHGPRPLATSAAVGIDPN
IQNSDSIEQTANDNSNAGPKLNFSDTENSFKTKTTLEICRALAVLKMCSYSYFVDNSFKL
MTTSQKILGEYITFRLLKSTFYGQFVAGHDVPTMAMCVERLKLAGIAPEIAIPLEDDLGG
PGASDEYRDSRCAENIKVMENCVDQSLQICDNSKPIVMQVRVSPLVQPEVLVKIGELIVK
NGYTYADGGPISIQNFAKGLNQVNDKIERISELTDSEFKHLNNTLYRLDRLARHAVSNNT
KILVDAEYTYLNPAMTLITLALMYKYNKTEPFIWNTYQNYLKDWTNFMSIMYIFLICCAA
HTNISRDIGMSEKLGFTFGVKLVRGAYIDREKERSKQMGYEDPINPDYEATNKMYNHNLV
MLLKLIQKHGKRYNMIIASHNEESINLAVNKINELGIDKTDGTVCFGQLLGMCDQVSYAL
GQNGYLAYKSLPVGTVDEVMPYLARRASENRSILAGAKRERKLLWGELKRRMLKI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccgatatgttgttccattgtgcactcgtctgtgtcaagctcatattcacgga
cgaaacggattgataacacaaagctttcgtcgtcgtcgtaccgatggccaacggcgccga
cacaaccatcacggtccaagaccactggcgacatcggccgctgtcggaattgacccaaac
atccagaattcagactccattgaacaaactgcgaatgataattcgaatgctggacccaag
ctgaacttcagtgatacagagaattcattcaaaaccaagacgacattggaaatatgtcga
gcgttggcggtgttgaaaatgtgctcttactcgtactttgtcgacaacagtttcaagttg
atgacaacatcgcagaagatccttggtgaatacataacctttcgcttattaaaatctact
ttttatggacaatttgtagcgggacatgatgtcccaacaatggcaatgtgtgttgagaga
ctcaagctggctggcattgcgccggaaatagctattccactagaagatgatttgggagga
cccggggccagcgacgaatacagggatagtagatgtgcggagaatatcaaagtgatggaa
aattgtgtagaccaatcattacaaatatgtgataactctaaaccaattgtaatgcaagta
cgagtcagcccattggtgcagcctgaagtgttggtaaaaattggtgagttaattgtgaag
aatggatatacctatgctgacggaggaccaataagtattcagaattttgctaaaggacta
aatcaagtcaatgataagatagagagaatttctgaactgactgattccgaatttaaacat
ctcaataacaccttatatcgtttagacagactggcacgacatgctgtatctaacaataca
aagattctagtagatgcggaatatacatacctcaatccagccatgacactgataactcta
gctttgatgtacaaatacaacaagactgagccattcatatggaacacatatcaaaattat
ctcaaggattggacaaattttatgtctattatgtatatttttcttatttgctgtgcagcg
cataccaacatcagcagagatattggaatgtctgaaaagttggggtttacgtttggtgta
aaactggttagaggagcatacattgatagggaaaaagaacgttccaaacaaatgggatat
gaagatcccatcaacccggattatgaagctacaaataaaatgtataatcataatttagtt
atgttattaaaattaatccaaaaacatggaaaacgatacaatatgattatagcatcccac
aatgaagaaagtataaatctagctgtaaacaaaataaatgaacttggtattgataagacg
gatggcacagtttgttttggtcagttgttaggaatgtgtgatcaagtatcctatgcctta
ggtcagaatggttatttagcatacaagtcattgccagtaggaacagtagatgaagtgatg
ccatacctagctagaagagcgtcggaaaatcgttcaatcttggctggtgctaaacgagaa
agaaaactattatggggagaactgaaaaggcgaatgttgaagatatga

DBGET integrated database retrieval system