KEGG   Saccoglossus kowalevskii (acorn worm): 102806176Help
Entry
102806176         CDS       T04123                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00010  Glycolysis / Gluconeogenesis
sko00562  Inositol phosphate metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102806176
   00562 Inositol phosphate metabolism
    102806176
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102806176
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102806176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 HPS3_N EHD_N
Motif
Other DBs
NCBI-GeneID: 102806176
NCBI-ProteinID: XP_006821711
Position
Un
AA seq 292 aa AA seqDB search
MDANNKLSLLASVMIILLTNSADPRSDGEFIGDLLVTKTTYEASFGGSEKMSAVLNATRT
RLQMVGESCVALQINALIRHVHVRKLYDLCANSMAIFNDASWCDVFTLEDLRIMEYWLDL
KHYWRKSYGYKINYHISCQLLQHIFSTLEDAMMDERTVLSNHDNSPVGVFRFGHAETFLP
LLSILGLYKDEDNILRYDNYHSNRNRTFRTSKLSPFAGNIAFVLYSCTDSTGNSMYMIEV
LLHEQPVTLPCCTSTLCSYDVIKQFYSTWLEDCDFTEICRMRNEKLPSKDEL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaataataaactgtcattattagcgtcagtgatgataatattgctgacgaac
tcggcagatccacgaagcgacggtgaatttataggcgatctgctcgtaacgaagacgacg
tacgaagcttcgtttggtggttctgagaagatgtcagctgtactgaatgctacgagaact
cgcctgcaaatggtcggtgaatcgtgtgttgctctgcaaatcaacgctttgataaggcac
gtacatgttcgaaaactctatgatctatgtgcaaattcaatggcaatttttaatgacgct
agttggtgtgatgttttcaccttggaagatctaaggattatggagtattggttagattta
aagcactattggaggaaaagctacggatataagattaattatcatattagttgtcagctt
ttacagcatatatttagtacgctggaagacgccatgatggacgaaaggacagtgttaagt
aaccatgacaactctcctgtgggtgtatttcgctttggacacgctgaaacatttttacca
ttgttaagtattcttgggttgtacaaagacgaagacaatatcttgagatatgacaattac
catagcaacaggaatagaacttttcgaaccagcaagctgtctccgtttgctggtaacata
gcctttgttttatacagctgtacagatagcactggaaactcaatgtatatgatagaggta
ttactccatgaacagccagtgactttaccgtgctgtacttcaactttatgctcctatgat
gttattaaacaattttattccacatggctggaagattgtgacttcacagagatttgtcgg
atgagaaatgaaaaactgccctctaaagatgaactttaa

DBGET integrated database retrieval system