KEGG   Saccoglossus kowalevskii (acorn worm): 102806212Help
Entry
102806212         CDS       T04123                                 

Definition
(RefSeq) palmitoyltransferase akr1-like
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    102806212
Enzymes [BR:sko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102806212
Membrane trafficking [BR:sko04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    102806212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 DHHC Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 102806212
NCBI-ProteinID: XP_006819902
Position
Un
AA seq 526 aa AA seqDB search
MATAPGIGMMANLMEAVQNFGVSDCARIIQLHPETVNLIGWSGLTPIHKAALRGNLEIVQ
LLIANGAFINQPNNAGELPVHYACKRGSPMIIHLLYLVEVVGSSLNKRDNSGISALHLAS
QFGHFDTVRYLLKNQRSDVNWMDHAGNLALHLACTNGHSDIAWVLLQKGKIAQINQKNKA
GDCPLNIARDGKSYRHAPLAKELAYWGSLRCQDHPPKGPLFSWYFLLLLPTIAFTFLILS
CSYLGVYGNVVALFGIFFLTCLIGRQMHRLAHMSRWSNPVFFGAFAGGLFHTSVCYFYLV
LPNILLYNVCLEQPYYAILTKDPGICRIPRRGPGKESPFMTIEHIATKELETEKYCIFCE
MSLPDRTRHCKLCENCMVEMDHHCLFLLRCVAANTHRLFVCFIIVVMSVQITFLFSAVKY
MQVSYEDMPLWDIPSTAFSEQVWLFTVCLVNIASIVWGTFLLRSQLEVISTGHTTVIRSQ
MNATKLLTFLDKLNNVCNFFRGLKTLTPEEICEMKATSLFENVHPL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcaccgggaatcgggatgatggcaaatcttatggaagcggtacaaaatttc
ggtgtatctgattgtgctcggatcattcaactacacccagaaactgttaatttaattggc
tggagtggattaacacccattcacaaagcagctctgcgaggaaatctagaaattgtccaa
ttattaatagctaatggtgcttttattaatcagccgaacaatgctggagaattacccgtc
cattatgcatgcaaacgagggagtcctatgattattcatttactatatctggttgaagtt
gttggttcatcattgaataagagagacaatagcggaatatctgccctacatctagcaagt
cagttcgggcattttgacacagttaggtatctactgaaaaaccagcgatccgatgtgaac
tggatggatcatgctgggaatcttgcactccatttagcatgtacaaacgggcattctgac
atagcatgggtgctgttgcagaagggaaaaattgcacagatcaaccagaaaaacaaggct
ggtgattgtccactaaatattgccagagacggaaaatcatacaggcatgctcctcttgcc
aaagagcttgcatactggggcagtttacgttgccaggaccatcctccaaaaggaccttta
ttttcgtggtattttctactgctcttaccaaccattgcatttacatttttaatactatcg
tgttcatatttgggcgtttatggtaatgttgttgccttatttggtatatttttcctgaca
tgtttaattggtcgacagatgcacagactagcgcatatgtcaaggtggagtaatccagtt
ttttttggagcgtttgctggcggcttatttcacacatcagtttgttatttctatctggtg
cttccaaatatccttttatataatgtatgtttggaacagccttattatgcaattttaacc
aaagatccaggtatatgtcgtataccaaggagaggacccggaaaagagtctccattcatg
acaatagaacacattgcaactaaggaattggaaactgaaaaatactgtatattttgtgag
atgtctttacccgaccgcacccgacattgtaagctatgtgagaactgcatggttgaaatg
gatcaccattgtcttttcctattaagatgtgtagctgctaacactcatcggctctttgtg
tgtttcatcatcgtcgtcatgtcggtacagattacgtttctcttttcggctgtgaagtat
atgcaagtgagttatgaggatatgccgctttgggatataccgagcacggctttttctgag
caggtctggctgttcactgtctgcttggtaaatattgcttccattgtctgggggacgttt
cttctgagaagtcagttggaggtgatatctacgggacataccactgttattcgctcacag
atgaatgctactaagctcttgacttttcttgataaattaaacaatgtgtgcaattttttc
agagggttaaaaacattgacgccagaagaaatttgtgaaatgaaagcaacgtctttgttt
gagaacgttcatcctctttag

DBGET integrated database retrieval system