KEGG   Saccoglossus kowalevskii (acorn worm): 102806877Help
Entry
102806877         CDS       T04123                                 

Definition
(RefSeq) insulin-degrading enzyme-like
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sko01002]
    102806877
Enzymes [BR:sko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     102806877
Peptidases and inhibitors [BR:sko01002]
 Metallo peptidases
  Family M16: pitrilysin family
   102806877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C RVT_1
Motif
Other DBs
NCBI-GeneID: 102806877
NCBI-ProteinID: XP_006823135
Position
Un
AA seq 498 aa AA seqDB search
TLDELQEMVVNLLSDVENKNCSIPEWLDPPFKDQNLRLRCDVVPVKDIRNLNVTFPIPDI
NPYYDSKPGHYLGHLIGHEGPGSLLSELKSKGWVNTLCGGQKDGAKGFMFFIINVDLTEE
GLDLSAAFDTIDRDILLARLADMGICDLAWQWLASYLTNRHQSIVINGHSSKETTLHYGV
PHRSDNISAAIFQIENCLFDIKAWMVNNKLQLNDGKDIANPNPLHGINIGSTLVKPVKAA
HNIGFIFDNSLQFISLLLFLNTYFSPSLHFTIVIMVLAILPCSFATSTFTNVSTNRAEHW
AGALCWDNTACGGHCVWGRTLGGTVEGDCVWDFPIPEVLSSGYLIKEFRPDLIEMLMNQL
VPDRIRIAVISQSFQGKTTHQERWYGTEYKITEIPEDTLQRWRNAGFNDKFTLPPRNEFI
PTKFEITPREEETAPFPVLIKDTSMTKLWFKQDDTFLLPKACMLFEFTSCESNKTPQFLA
LDEALTNSSPIAILDKGH
NT seq 1499 nt NT seq  +upstreamnt  +downstreamnt
aaacactagatgaactacaagaaatggttgttaacctattgtctgatgtagaaaataaaa
attgttcaatcccagaatggcttgatcctccattcaaagatcaaaatctcaggttacgat
gcgatgtagttcctgtgaaagatatcagaaatcttaacgtcacctttcctattccagaca
tcaacccatactatgactctaagcctggccactatcttggtcatttaattggacatgagg
gtccaggcagtttactatcggaattgaaaagtaaaggctgggtcaacacgctatgtggag
gccagaaagatggtgcaaagggctttatgttctttatcatcaacgttgatctaactgaag
aaggacttgacctgtctgctgcctttgacacaatcgaccgtgacatccttcttgcacggc
tagcagatatgggcatatgtgatctcgcctggcaatggctagcttcatatctcacgaaca
gacatcagtcaattgtcattaatggtcattcatctaaagaaacaactcttcattatggag
ttccccatagatcagataacatttcagctgccatattccaaattgaaaattgcctatttg
acatcaaggcttggatggttaacaacaaactacagctaaatgatggcaaagatattgcta
atccaaaccccttgcatggtatcaacattggatcaacactcgttaaaccagttaaagcag
ctcacaacattggtttcatctttgataattcacttcagttcatttctttactactgtttt
taaatacctacttttcaccatcacttcattttaccattgtaattatggtgctcgccattc
taccttgtagctttgctacctctacatttactaatgtatctaccaatagagctgaacact
gggcaggggcactgtgttgggataacactgcgtgtggggggcactgtgtgtggggaagaa
cactggggggcactgtggaaggagactgtgtgtgggactttccaattccagaagtactga
gtagtgggtacctgataaaggagttcagacctgatctgattgaaatgttgatgaatcaat
tggtacctgatagaataagaattgctgttatatcgcagtcatttcaaggcaagactacac
accaggaaagatggtatggaacagaatacaaaatcacagaaataccagaagacactttac
agcgatggagaaatgcaggattcaatgataaatttactctgccaccaagaaatgaattca
tcccaacaaaatttgagatcacacccagggaagaagagaccgcaccattcccagtactga
tcaaggacacttcaatgactaaactgtggttcaaacaggatgatacttttctgcttccaa
aggcttgtatgctctttgaattcacaagctgcgaatcaaacaagacacctcagtttctag
cacttgacgaagcactaaccaattcttcaccaattgcgatactagacaaaggacactag

DBGET integrated database retrieval system