KEGG   Sphingomonas koreensis: BRX40_00155Help
Entry
BRX40_00155       CDS       T04828                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
skr  Sphingomonas koreensis
Pathway
skr00071  Fatty acid degradation
skr00072  Synthesis and degradation of ketone bodies
skr00280  Valine, leucine and isoleucine degradation
skr00310  Lysine degradation
skr00362  Benzoate degradation
skr00380  Tryptophan metabolism
skr00620  Pyruvate metabolism
skr00630  Glyoxylate and dicarboxylate metabolism
skr00640  Propanoate metabolism
skr00650  Butanoate metabolism
skr00900  Terpenoid backbone biosynthesis
skr01100  Metabolic pathways
skr01110  Biosynthesis of secondary metabolites
skr01120  Microbial metabolism in diverse environments
skr01130  Biosynthesis of antibiotics
skr01200  Carbon metabolism
skr01212  Fatty acid metabolism
skr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRX40_00155
   00630 Glyoxylate and dicarboxylate metabolism
    BRX40_00155
   00640 Propanoate metabolism
    BRX40_00155
   00650 Butanoate metabolism
    BRX40_00155
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRX40_00155
   00072 Synthesis and degradation of ketone bodies
    BRX40_00155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRX40_00155
   00310 Lysine degradation
    BRX40_00155
   00380 Tryptophan metabolism
    BRX40_00155
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRX40_00155
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRX40_00155
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRX40_00155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:skr04147]
    BRX40_00155
Enzymes [BR:skr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRX40_00155
Exosome [BR:skr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRX40_00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APR51051
UniProt: A0A1L6J529
Position
complement(27802..28983)
Genome map
AA seq 393 aa AA seqDB search
MSDVLILSGVRTAIGDFGGALKNVPAADLGALVIGEAIARAGIAADAVGHVVMGNVIPST
PSDAYLARVAAVRAGVPVAVPALTVNRLCGSGLQAIISAAQGIALGECGVAVAGGAENMS
QAPHYVASARFGQKMGDIQMLDALTRTLSDPFDQVHMGVTAENVAAQCGIDRAAQDEAAV
ESHRRGARAIAEGRFRDQIVPVEIKSRGGTVMFDTDEHVRAEATLEDMARLRPAFQRDGT
VTAGNASGINDGAAAVVLGSPEEAQRLGAKPLARILGWGHAGVEPRVMGLGPVEAVPIAL
RRAGVTLDRIDVIESNEAFAAQACAVSAQLGFDPEKTNVNGSGISLGHPVGATGAINTVK
LLYELQRSGGRLGLVTMCIGGGQGIALVIERLG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgttctcatcctctccggcgtccgtaccgcgatcggcgactttggcggcgcc
ctgaagaacgtgcccgcggcggatctgggcgcgctggtgatcggcgaggcgattgcgcgc
gccggtatcgcagccgatgcggtcgggcatgtggtgatgggcaatgtgatcccttctacg
cccagcgacgcctatctggcgcgcgtcgcggcggtgcgcgcgggcgtgccggtggcggtg
cccgcactgaccgtgaaccggctgtgcggatcggggctacaggcgatcatctccgcggca
cagggcattgcgcttggtgaatgcggcgtggcggtcgcgggcggcgccgagaatatgagc
caggcgccgcattatgtggccagcgcgcggttcggccagaagatgggcgacatccagatg
ctcgacgcgcttacccgtacgctgagcgatccgttcgaccaggttcatatgggggtgact
gcggagaatgtcgcggcgcaatgcggcatcgatcgggcggcgcaggacgaagccgcagtc
gagagccatcgccgcggcgcgcgtgcgatcgccgagggacgtttccgcgatcagatcgta
ccggtcgagatcaagagccgcggcggcaccgtgatgttcgataccgacgagcatgtccgg
gccgaggcgacgctggaggatatggcgaggctgcgccctgccttccagcgcgacggaacg
gtcaccgcgggcaacgcttcgggaatcaacgatggtgctgcggcggtggtgctgggctcg
cccgaggaagcgcagcgacttggggccaagccgctcgcacggatcctgggctggggccat
gccggggtggagccccgggtgatggggcttgggccggtcgaggcggtgccgatcgcactg
cggcgcgcgggcgtgacgctcgaccggatcgatgtgatcgaatccaacgaagcgttcgcg
gcgcaggcatgcgcggtatcggcgcagctcgggttcgatcccgaaaagacgaacgtcaac
ggatccggcatctcgcttggccacccggtcggcgcaaccggggcgatcaataccgtcaag
ctcctctatgaactccagcgatcgggcggccgcctcggcctggttacgatgtgcatcggc
ggagggcagggcatcgcgctggtgatcgagcgactgggctga

DBGET integrated database retrieval system