KEGG   Sphingomonas koreensis: BRX40_00200Help
Entry
BRX40_00200       CDS       T04828                                 

Definition
(GenBank) hypothetical protein
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
skr  Sphingomonas koreensis
Pathway
skr00561  Glycerolipid metabolism
skr00640  Propanoate metabolism
skr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BRX40_00200
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BRX40_00200
Enzymes [BR:skr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BRX40_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: APR51060
UniProt: A0A1L6J672
Position
complement(35843..36919)
Genome map
AA seq 358 aa AA seqDB search
MIRIFGGPTRYVQGPGAIGELGTLTERLTKRPLLVVDADVLPFVEAQLSTAFTGRPSITL
AFRGEVTHAAIDLLVEQADDADCVIGIGGGKGLDAAKGVAFKLGLPFIAVPSIASNDSPT
GRSMAIYNDEHVLVAIETIPDSPLLVVTDTQLIANAPARFLRTGMGDALAKKFEAERAVA
DGASNFFGTGQLRTALAIADACYQTLREHGVAAMAAAERHEPDEAFEAVVEANVLMAGLA
WESGGLSYAHAVVRGLVKARGAASAPHGDHVGYATLVQLAIEGRDDGFILDVIGFNRSVG
LPASLAELDMGSPTPDEIAEIARLTTIGPKGGRIIVNADPGQIADAIKRVEQLATRES
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggatctttggcgggccgacccgctatgtgcagggcccaggcgccatcggcgaa
ctcggcacgcttacggaacggctgacaaaacggcctttgctggtggtcgatgccgatgtg
ctgcccttcgtcgaggcgcaactctcgaccgcctttaccgggcgtcccagtatcacgctc
gcctttcgcggcgaggtcactcacgccgccatcgacctgctggtcgaacaggccgacgac
gcggattgcgtgatcggcatcggcgggggcaagggactcgatgcggccaagggggtggca
ttcaagctgggcctcccgttcattgccgtgccttcgatcgcgtccaacgactcgcccacg
ggccgctcgatggcgatctataatgacgagcatgtgctggtcgcgatcgagacgatcccc
gacagcccgttgctggtcgtcaccgacacgcaattgatcgcgaatgcgcccgcacgcttc
ctgcggacgggcatgggcgacgcgcttgccaagaagttcgaggcggagcgcgcggtggcc
gatggtgcgagcaacttcttcggaacaggccagttgcgcacggcattggcgattgccgat
gcctgttatcagacgctgcgcgaacatggcgtagcggcgatggcggcagccgaacggcac
gagcccgatgaggcgttcgaggcagtggtcgaagcgaatgttctgatggcggggctcgcc
tgggagagcggcggcctatcctacgcccatgctgtcgtacgcgggctggtcaaggcgcgt
ggcgccgccagcgcaccgcatggcgaccatgtcggctatgcgacgctggttcagcttgcc
atcgagggacgcgatgacgggtttatcctcgacgtgatcggcttcaaccgaagcgtcggt
ctgcctgcctcgttggcggagctggacatgggatcgccgacgccggatgaaatcgccgaa
atcgcgcggttgacgacaatcgggcccaagggcggccgcatcatcgtgaatgctgacccc
ggccagatcgcagacgccatcaagcgggtcgagcaactggcgacccgggaatcgtga

DBGET integrated database retrieval system