KEGG   Sphingomonas koreensis: BRX40_00625Help
Entry
BRX40_00625       CDS       T04828                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
skr  Sphingomonas koreensis
Pathway
skr00480  Glutathione metabolism
skr00590  Arachidonic acid metabolism
skr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BRX40_00625
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRX40_00625
Enzymes [BR:skr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRX40_00625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APR51132
UniProt: A0A1L6J5A4
Position
122773..123321
Genome map
AA seq 182 aa AA seqDB search
MTKLQDIPVRMIDGRETRLSEHAGKALLIVNTASKCGLTPQYEGLEALYRTYRDRGFEVL
GFPSNDFRGQEPGTDAEIADFCQSIYAVDFPMFAKMVVAGPDKHPLYAALIEAQPAAVST
SGGAMRARLESHGIAVNPAPEVQWNFEKFVVAPDGSVTTRFAPDTLPADPAILAAIEEQL
PR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcttcaggacattccggtaagaatgatcgatggccgcgagactcggctctcc
gaacatgccggcaaggcgctgctgatcgtcaacaccgcctccaaatgcggcctgaccccg
caatatgaaggacttgaggcgctgtaccgcacctatcgcgaccgggggttcgaagtgctg
gggtttccctccaacgatttccgcgggcaggagccgggaacggatgccgagatcgccgac
ttctgccagtccatctacgccgtggatttcccgatgttcgccaagatggtcgtggcgggc
ccggacaagcacccgctctatgctgccctgatcgaggcgcagcctgccgccgtcagcacc
agcggcggcgcgatgcgtgccaggctggagagccatggcatcgcggtgaacccggcaccc
gaagtgcaatggaatttcgagaagttcgtggtcgctccggacggcagcgtcaccacgcgg
ttcgcgcccgatacgctgcccgccgacccggcgatcctcgcagcaatcgaagaacagctt
ccgcgctga

DBGET integrated database retrieval system