KEGG   Sphingomonas koreensis: BRX40_04180Help
Entry
BRX40_04180       CDS       T04828                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
skr  Sphingomonas koreensis
Pathway
skr00270  Cysteine and methionine metabolism
skr00920  Sulfur metabolism
skr01100  Metabolic pathways
skr01110  Biosynthesis of secondary metabolites
skr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BRX40_04180
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BRX40_04180
Enzymes [BR:skr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BRX40_04180
    2.3.1.46  homoserine O-succinyltransferase
     BRX40_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Hydrolase_4 DUF4777 Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: APR51742
UniProt: A0A1L6J717
Position
836473..837588
Genome map
AA seq 371 aa AA seqDB search
MSDDQRFGLSRHVTLPGPLRLDGGVLLSPVEIAYETYGTLAPDGGNAILICHALTGDQHV
ASPHPVTGKPGWWTRMVGPGKPVDPDRHFIVCANVLGSCMGSSGPATVNPATGRPWGMDF
PVITIRDMVRAQAMLLDHLGVGRLKAVVGGSMGGMQALSWPATFPDRVDAVVVIASTARH
SAQNIAFHEVGRQAVMADPRWNGGAYYDGDPPAAGLAVARMAAHITYLSEAGLTEKFGRR
LQAREAKSFGFDADFQIESYLRHQGLSFVDRFDANAYLYITRAMDYFDLAEEHGGLLANA
FRETRARFCLVSFDTDWLYPTRDSRAIVHALNAAGAPVSFVELSSPFGHDAFLLEAPELN
RVVDGFLRAGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgaccagcgtttcggtctttcgcgccacgtcaccctgcccgggccgctccgg
ctcgacggtggcgtgctgctgtcgccggtcgagatcgcgtacgagacctacgggacgctc
gcgcccgatggcggcaacgcgatcctgatctgccatgcattgaccggcgaccagcatgtc
gcttcgccgcatcccgtgacgggcaagcccggctggtggacgcggatggtggggccgggc
aagccggtcgatcccgatcggcacttcatcgtctgtgccaatgtgctgggcagctgcatg
ggcagttcaggccccgccacggtcaatcccgcgaccggcaggccctggggcatggatttt
ccggtcatcaccatccgcgacatggtccgtgcgcaggcgatgctgctcgaccatctcggt
gtcgggcggctgaaggcggtggtcggcggatcgatgggcgggatgcaggcgctgagctgg
cccgcgaccttccccgaccgggtcgatgcggtggtggtgatcgcctcgaccgcacggcat
tcggcacagaacatcgccttccacgaggtcgggcgtcaggcggtgatggccgatccgcgg
tggaacggcggcgcctattatgacggcgatccgcccgctgcgggcctcgccgtcgcgcgc
atggcggcgcatatcacctatctgtccgaggcgggtctgaccgagaaattcgggcggcgg
cttcaggcgcgtgaggcgaagtcgttcggcttcgacgccgacttccagatcgaaagctat
ctgcgccatcaaggcctctcgttcgtcgatcggttcgatgccaacgcctatctctacatc
acacgcgcgatggactatttcgacctggccgaggagcatggcggcctgctcgccaacgcc
ttccgcgagaccagagcgcgcttctgcctcgtcagtttcgacaccgactggctctatccc
actcgcgattcgcgcgcgatcgtccatgcgctcaacgcggcgggcgcgccggtcagcttc
gtcgagctgtcctcgcccttcggccatgacgccttcctgctcgaggcgcccgaattgaac
cgcgtcgtcgatgggttcctgagggcggggcgatga

DBGET integrated database retrieval system