KEGG   Sphingomonas koreensis: BRX40_04345Help
Entry
BRX40_04345       CDS       T04828                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
skr  Sphingomonas koreensis
Pathway
skr00740  Riboflavin metabolism
skr00790  Folate biosynthesis
skr01100  Metabolic pathways
skr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BRX40_04345
   00790 Folate biosynthesis
    BRX40_04345
Enzymes [BR:skr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BRX40_04345
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BRX40_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: APR51769
UniProt: A0A1L6J781
Position
complement(876123..877277)
Genome map
AA seq 384 aa AA seqDB search
MAQPGKNPELARLRHAFLSTPEEIIDEARNGRMFILVDDEDRENEGDLVIPAQMATPDAI
NFMAKHGRGLICLAMTKERTDQLGLEPMARRNGTRMGTAFTVSIEAKEGVTTGISAADRA
RTVAVAIDASNGPADLVSPGHVFPLVAREGGVLVRAGHTEAAVDVARLAGLNPSGVICEV
MKDDGTMARLDDLVSFAQLHNLKIGTIRDLIAYRHRYDHLVERRAETSFTSRWGGDWRVV
TFWNKAAGTEQIALLKGRVSPDKPTLVRMHVLSPFGDLFGEEGARGKLLERSMQIIGEEG
AGVIVVINRPRADAFTMAVERKAGIRTEADMEELRDYGVGAMILTELGVEEMILLTNTHH
TLVGLDGYGLSIVGERPIDLGGNG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtggcccagcccggtaagaatcccgaactcgcacgcctgcgccacgccttcctctccacg
cccgaagagatcatcgacgaggcgcgaaacggccgcatgttcatcctggtcgacgacgag
gaccgcgagaatgagggcgacctggtcatcccagcccagatggcgacccccgacgcgatc
aacttcatggccaagcatggccgcggcctgatctgtctagcaatgaccaaggagcgcacc
gatcagcttgggctcgagccgatggcgcgccgcaacggcacgcgcatgggcaccgccttc
accgtatcgatcgaggcgaaggagggcgtcaccaccggcatctccgccgccgaccgcgcg
cgcaccgtcgcggtcgcgatcgacgcgagcaacggtcctgccgacctcgtctcgcccggc
catgtcttcccgctcgtcgcgcgcgaaggcggcgtgctcgtccgcgccggccataccgag
gccgcggtcgacgtcgcacgcctcgcaggcctcaacccctcgggcgtgatctgcgaggtg
atgaaggacgacgggacgatggcccggctcgacgatctcgtttccttcgcgcagctccac
aacctcaagatcggcacgatccgtgatctgatcgcctatcgccaccgctacgatcatctc
gtcgagcgtcgcgcggagaccagcttcaccagccgctggggcggcgactggcgcgtcgtc
accttctggaacaaggccgctggtaccgagcagatcgccctgctcaagggccgcgtcagt
cccgacaagcccacgctggtccgcatgcatgtcctctcgcccttcggcgatctgttcggc
gaagagggcgcgcgcggcaagctgctcgaacggtcgatgcagatcatcggcgaagagggc
gcgggcgtgatcgtcgtcatcaaccggccgcgcgccgatgccttcaccatggcggtcgag
cgcaaggccggcatccgcaccgaggcggatatggaggagctgcgcgactatggcgtcggc
gcgatgatcctgaccgagctcggcgtcgaggagatgatcctcctcaccaacacccaccac
acgctggtcggtcttgacggctacggcctgtcgatcgtcggcgaacgcccgatcgacctc
ggaggaaatggctga

DBGET integrated database retrieval system