KEGG   Salinivibrio kushneri: FCN78_03165Help
Entry
FCN78_03165       CDS       T05956                                 

Gene name
rlmM
Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sks  Salinivibrio kushneri
Brite
KEGG Orthology (KO) [BR:sks00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sks03009]
    FCN78_03165 (rlmM)
Enzymes [BR:sks01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     FCN78_03165 (rlmM)
Ribosome biogenesis [BR:sks03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    FCN78_03165 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: QCP01485
UniProt: A0A1V3GIH1
Position
1:657884..658960
Genome map
AA seq 358 aa AA seqDB search
MNQVLLYCRAGFEKDCAAEIQQKTTDMGVYGFPRVVNHSAYVLFECYQEGDAERVVRDLP
LDSLIFARQMIAITASLSELDPDDRISPILAVGEHLPKGGDLRVETPDNDEAKALLKFCR
KFTVPLRQALRKKGVLLAKDNPKKPVIHVCFTAPGTCLIGYSLTTNNSPHYMGLPRMKFP
ADAPSRSTLKLEEAFHHFIPKQEWETRLAPGMWAVDLGASPGGWTYQLVKRSMFVHAVDN
GAMDEQLMETGQVFHHAEDGFKFEPTRKNVTWLVCDMIEKPSRVAQLMGEWLIEGWAKEA
IFNLKLPMSRRYEQVTENLDTLGAFLDDYNVAYEMRAKHLYHDREEITVHLRRVKRQR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggttctgctttattgtcgtgcggggtttgagaaagactgtgccgcagagatc
caacaaaaaaccaccgacatgggggtatatgggttcccgcgcgtggttaatcatagtgcg
tatgtcctgtttgagtgttatcaagagggcgatgccgagcgtgttgtgcgtgatctcccg
ctagactcactgatttttgcccggcaaatgatcgctatcaccgcctccctttctgagctt
gaccctgacgatcgtatctcaccgattttggcggtgggcgagcacttacccaaaggcggc
gacctacgggtggaaaccccagataatgacgaagcgaaagccctgttgaagttttgtcgt
aaattcaccgtgccactgcgccaagccttacgtaaaaaaggggtactgcttgcaaaagat
aaccccaaaaagccggtgatccatgtgtgttttaccgccccaggcacctgcttgattggc
tactctctgacaaccaataactccccgcattatatggggttgccgcgaatgaagtttcct
gctgatgcgccgagccgctcgaccttaaagttggaagaggcgtttcatcactttattccc
aagcaagaatgggagacgcgtttagcgcctggcatgtgggcggtcgacttaggggcgagc
cctggaggctggacctatcagttggttaaacgctcgatgtttgtccacgcggtcgataac
ggcgcaatggatgagcaattgatggaaaccggacaagtctttcaccacgctgaagatgga
tttaagttcgagccgacgcgtaagaatgtcacttggctggtatgcgatatgattgaaaag
ccttctcgtgtagcccaattgatgggggagtggctgattgaagggtgggcgaaagaggca
atatttaatttgaaattgccgatgagccgccgctatgagcaggtgacggagaacctcgac
accctaggcgcctttcttgatgactacaacgtggcgtatgaaatgcgcgcgaagcatctg
taccatgatcgcgaggaaatcacggtgcatttacggcgggttaaacgccagcgttaa

DBGET integrated database retrieval system