KEGG   Sulfuricurvum kujiense: Sulku_0610Help
Entry
Sulku_0610        CDS       T01370                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sku  Sulfuricurvum kujiense
Brite
KEGG Orthology (KO) [BR:sku00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Sulku_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 4HB_MCP_1 DUF1351 TolA_bind_tri
Motif
Other DBs
NCBI-ProteinID: ADR33276
UniProt: E4U0Q0
Position
complement(590445..591926)
Genome map
AA seq 493 aa AA seqDB search
MFSRDNLFFGTVFVLMTAAFMVWGFNYLENNYTLFILATLFGIFMAFNIGGNDVANSFGT
SVGAKTLTVKQALMIAAIFELGGAMLAGAEVTNTIRKGIVDISAMDFDPMLLVFVMMGSL
LSAGTWLLYATFKGYPVSTTHAIIGGILGGSIALGYATMEVGESVFGLVHWDQVTKIAIS
WVVSPILGGMASYGIYWYLKKFILDYNDNVQAHIDEIKVQVTALKASYNEATATSEEKGR
FEEQMHELNRLKKKQNAFYALRTHAPIVAAFGTAMITGMLLFKGLKHANLGLNDAQIYML
LAVLSTLMYGVVYAIIKVMHKDTPHKATMRVFSMLQVLTASSFAFSHGANDIANAIGPFA
AIIDILATGKINAESPVPFIAMATFGIALVAGLWFIGKEVIDTVGSRITEIFPVTGFAAE
LGATLVILLATVLGIPVSSTHILVGAIIGIGVLNRDANWKLMKPIAMAWVITLPAAAAMA
ALFFFALKVTFGY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgtgacaatctctttttcggcactgtttttgtccttatgaccgccgcattt
atggtgtggggatttaactatctcgaaaacaactacactcttttcattttagctaccctt
tttgggattttcatggcgtttaacatcggcggtaacgatgtcgccaactcattcggtacc
agtgtaggggcaaaaaccctcaccgtcaaacaagcgcttatgattgccgcaatcttcgaa
ctcggcggagctatgcttgcgggtgccgaagtgactaacactatccgtaaagggatcgtc
gacatttcggcaatggattttgatccaatgttgctcgtatttgttatgatgggttcactc
ctctctgcgggaacgtggctgttgtatgcgacattcaaagggtatcctgtctccacaacg
catgccattatcggagggattttagggggctcaatcgcccttggatacgctacgatggaa
gtgggagaatctgtattcggtctggttcactgggatcaagtcaccaaaattgccatcagc
tgggtcgtttcaccgattctaggcggtatggcgtcgtatgggatatattggtatttaaag
aaatttattcttgattacaatgataatgtccaagcccatattgatgagatcaaagtgcaa
gtgactgcacttaaagcctcttacaatgaagcgaccgcaacctctgaagagaaaggtcgt
tttgaagagcaaatgcatgagctcaatcgtctcaagaaaaaacaaaacgctttctatgct
cttcgtacccatgcgccgatcgttgcggcattcggtacggcgatgattaccggtatgctc
ttgtttaaaggtcttaaacacgcaaatttgggtctcaacgatgcccaaatctatatgttg
cttgcggtgttgtccacccttatgtacggtgtcgtctatgctatcatcaaagtcatgcat
aaagatactccgcacaaagcgacaatgcgggtatttagcatgctccaagtccttacagcg
tcatcattcgcatttagccacggggcaaacgatattgcgaatgccatcgggccgtttgcc
gctattatcgatattctggcgacaggtaaaatcaatgcggaatcccctgtcccgtttatc
gcaatggcgacctttggaattgcgcttgtagccggattatggttcatcggcaaagaggtt
attgacactgtcggcagccgaattactgaaatcttcccggtaaccggtttcgcagcagag
ctcggagcaacgttggttatcttattggcaaccgtgttagggattcctgtttcatcaacc
catatccttgtcggtgctattatcggtatcggcgtactcaatcgtgatgctaactggaaa
ttaatgaaaccgattgccatggcgtgggtcattacattaccggcagctgcagctatggca
gccctcttcttcttcgccctaaaagtgacattcggctattaa

DBGET integrated database retrieval system