KEGG   Sulfuricurvum kujiense: Sulku_0769Help
Entry
Sulku_0769        CDS       T01370                                 

Definition
(GenBank) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00061  Fatty acid biosynthesis
sku01100  Metabolic pathways
sku01130  Biosynthesis of antibiotics
sku01212  Fatty acid metabolism
Module
sku_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Sulku_0769
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Sulku_0769
Enzymes [BR:sku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     Sulku_0769
Lipid biosynthesis proteins [BR:sku01004]
 Fatty acid synthase
  Component type
   Sulku_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1
Motif
Other DBs
NCBI-ProteinID: ADR33435
UniProt: E4U1J9
Position
758880..759815
Genome map
AA seq 311 aa AA seqDB search
MSKKIAMIFPGQGSQSIGMGKSFYENSALAREMFEKTGERIGVDFAKLLFEENDQLDKTE
YTQPAILLVSMIAYKLFQESRPSDAVMFLGHSLGEFSALCASGAINYVDAVELVHKRGKL
MSQACESINAGMMAILGLDDAVVEELCAKANSEGKQVWPANYNQAGQLVVAGIKEDLQSM
ESVFKEAGAKRALLLNMSIASHCPLLSSAMEPLGEAMEAMVNDSFSAPIVSNVTTEKYAT
KSEALKLLKVQLIQPVKYKQSIEAVAGEIDMMIEFGNGAVLKGLNKRNAPDVETLGISDM
ESLSKVCEALS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcgcgatgattttccctggtcagggaagccagagcatcggtatgggt
aaatcgttttatgaaaacagcgcgctcgctcgtgaaatgtttgaaaaaacgggcgagcgt
atcggagttgattttgcaaaacttttgtttgaggaaaacgatcaactcgataaaaccgaa
tacacccaacccgcgattttattggtatcgatgatcgcctataaattgtttcaagaatcc
cgaccgagtgatgccgtaatgtttttgggccactctttgggcgaatttagtgctctatgc
gccagcggtgcgatcaactatgtcgatgcggttgaattggtgcataaacgtggaaagctt
atgtctcaggcatgtgagagcattaatgcggggatgatggctattttgggtcttgatgac
gcagtggtcgaagaactttgcgcaaaagcaaatagcgagggcaagcaggtgtggcctgcc
aattataaccaagcgggtcagcttgttgttgccggcattaaagaagatcttcaatcgatg
gagagcgtattcaaagaagcgggtgcgaagagggcattattgctgaacatgtcaatcgcc
agccactgtccgctcctctcaagtgctatggagccgctgggcgaagcgatggaagcaatg
gtgaatgacagtttcagcgctccgatcgtatcgaacgtaacgactgaaaagtatgcgacg
aaatccgaggcattgaaactgcttaaagttcagttgattcagcccgttaaatacaagcaa
tcgatcgaagcggttgccggcgagatcgatatgatgatcgaattcggtaacggtgcggtt
ttaaaagggctgaataaacgcaatgccccggatgtcgagacattgggcatttcggatatg
gaatcgcttagcaaggtttgtgaagcactctcatga

DBGET integrated database retrieval system