KEGG   Sulfuricurvum kujiense: Sulku_1019Help
Entry
Sulku_1019        CDS       T01370                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00260  Glycine, serine and threonine metabolism
sku00750  Vitamin B6 metabolism
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
sku01120  Microbial metabolism in diverse environments
sku01230  Biosynthesis of amino acids
Module
sku_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulku_1019
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sulku_1019
Enzymes [BR:sku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sulku_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Glyco_transf_6
Motif
Other DBs
NCBI-ProteinID: ADR33682
UniProt: E4U312
Position
1023157..1024626
Genome map
AA seq 489 aa AA seqDB search
MKFIETRGNDGIHPQQVTFSEAILSPIASFGGLYVPSSLPMLGEPFLTKHLNSSYKELAK
DLLTTLAIDIDGSVIDEALSLYDKFDDPTNPVPVVKVRDDLYVSELYHGPTRAFKDMALQ
PFGVVLSSIAQKRGEEYLILAATSGDTGPAALETFKNRANVRVACLYPDGGTSDVQRLQM
VTEDASNLKVIGIKGDFDDAQSALKKLLASQTFKDALKAKNISLSAANSVNFGRIIFQII
YHIHSYLELVRQNVIAMGEKVYLDVPSGNFGNALGGYYAYKMGLPVEKIIIASNENNVLT
RLINTGRYDLRGEHVVATTSPAMDILISSNVERILFDLFGYERTKELMAGLEAERFYALS
DNETMKLQNLFTADYCNGAEGKGYIKEAFDHGYLMDPHTATCFKAYDCCATKPLKTIVYS
TAEWTKFSPTIANALTGEKDANDIDALESISTTAKTPIPAMIKGLFSKPVTQATVIEKEN
IEAEILKFL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattgaaacacgcggaaatgacggaatccatccacagcaggtgactttttca
gaggcgattttaagtcctatcgcatcgttcggcgggttgtatgtccccagcagccttccg
atgttgggtgagccgtttcttacgaaacatctgaattcatcctataaagagttggcaaaa
gatttgttgacaacacttgcgatcgatattgacggatcggtcattgacgaagcactgtca
ctttacgataaatttgatgatccgaccaatcctgtaccggttgtcaaagttcgtgatgat
ctttatgtaagcgagctctatcacggtccgacccgtgcgttcaaagacatggcgttgcag
ccgttcggtgtcgtactcagctccatcgcccaaaagcgcggtgaagagtatctgattttg
gcagcaaccagcggtgataccggtcctgcggcgctagagacgttcaaaaacagagcgaac
gtccgtgtcgcctgcctctatcctgacggcggtacgtcggatgttcagcgtcttcagatg
gtgaccgaggatgcctcaaatctcaaagtaatcgggatcaaaggggattttgatgatgct
caaagcgcattgaaaaagcttttggcgtctcaaacgtttaaggatgccctgaaagcgaaa
aatatctccctctctgcggcaaactcggtcaacttcggacggatcatttttcaaatcatc
tatcacatccacagctaccttgaactcgttcgccaaaacgtcatcgcaatgggtgaaaaa
gtctatcttgatgttccgagcgggaatttcgggaatgcgctgggcggatattacgcctat
aaaatgggtcttccggtcgagaaaatcattatcgcttcgaatgagaacaatgttttgacc
cgtttgatcaatacggggcgctatgatctgcgtggggagcatgtcgtcgctacgacatcc
ccggctatggatattttgatctccagcaatgtcgagcgcatcttgttcgatctcttcgga
tatgagcgtaccaaagagctgatggcagggttggaagcggaacgtttctatgcgcttagc
gataatgagacgatgaaactgcaaaacctttttacggccgattactgtaacggcgccgag
gggaaagggtatatcaaagaggcattcgatcacggctatttgatggatccgcatacggcg
acctgtttcaaagcgtatgactgctgtgcgaccaaaccgcttaaaacaatcgtttactcg
actgccgagtggacgaagttttctccgacgatcgccaatgctcttacgggtgagaaagac
gctaacgatatcgatgcattggaatccatttcaacgacagctaaaacaccgatccctgcg
atgattaaagggctgtttagcaaaccggttactcaggcaacggtaatcgaaaaagagaat
attgaagctgaaattctaaaatttttataa

DBGET integrated database retrieval system