KEGG   Sulfuricurvum kujiense: Sulku_1034
Entry
Sulku_1034        CDS       T01370                                 
Name
(GenBank) outer membrane porin
Organism
sku  Sulfuricurvum kujiense
SSDB
Motif
Pfam: OprD Porin_4
Other DBs
NCBI-ProteinID: ADR33697
UniProt: E4U327
Position
1038132..1039352
AA seq 406 aa
MALGTSAFAIDNAKVNGGIKFIYQTADWELTSAEKASGLYETGLFKQGNINNPISGASYG
GAASGGLSFSVGGTADLTQGVSAGAEVQGFTTLGLENNLVIGSMQGSRLDVDDAASMAQL
WMATTLGKTTVKAGRMELDTPLAFTEKWNLIKNTFDAAVVLNNDLPNTTLVAAWVGKHNG
DTTGAGYVAHLNTYTTFGVSGAYAFGAINKSIPNTTAQAWYYNVCDVADAYWLQADAKLV
GMIDVGAQYANLDPKASGPKDSSIWAVKASADVAGFNVYAAYSDADEDGTASFANVSTND
KTKIYTGDGSIYMDGIVTRPGTEAFKIGASTKMVPGVSLAASYCDASDVSVQNHDISAWD
VSASGKIGALGLTAIYTQVNNDTDGTSQVYAGRDNDTLRLIATLAF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggctcttggaacaagtgcatttgctattgataatgcaaaagtaaatggtggaattaaa
tttatctatcaaactgccgattgggaattgacaagcgctgaaaaagcaagtggattatat
gaaaccggtttgttcaagcaaggtaatattaataatcctataagcggagcttcctatggc
ggagctgcatcaggcggtctttctttttctgtcggcggaacagctgatcttactcaaggt
gtcagtgccggtgctgaagtgcaaggattcacaacactcggtttagaaaacaacctagta
atcggttctatgcaaggaagcagactggatgtggatgatgctgcctctatggcacaattg
tggatggcaaccactttgggcaaaacaacggtaaaagcaggacgtatggaacttgataca
ccgcttgcatttacagaaaaatggaatttgattaaaaatacatttgatgcggccgttgta
ttgaataatgatcttccgaatacaactttggttgcagcttgggttggaaaacataatggt
gacactacaggtgcaggttatgtagctcatctaaatacatatacaactttcggtgtaagc
ggtgcttatgcattcggtgcgattaacaagtctattccaaatacaaccgcacaagcatgg
tattacaacgtttgtgacgttgcagatgcctattggttgcaagcagacgcaaaattggta
ggtatgatagatgtcggcgctcaatatgcaaatttggatcctaaagcttctggtcctaaa
gattctagcatttgggccgttaaggcttctgctgatgtagcaggattcaatgtttacgca
gcatattcagatgctgacgaagacggtactgcaagttttgctaacgtttcaacaaacgat
aaaactaaaatttatacgggcgatggttcaatctacatggatggaattgtaactcgaccg
ggtacagaggcatttaaaatcggtgcatcaacaaaaatggttccgggtgtaagtttagct
gcaagttattgtgatgcaagcgatgtttcagtgcaaaatcatgacatctcagcatgggat
gtatctgcgagcggaaaaatcggtgcacttggtttgacagcgatttatacgcaagttaac
aatgatacggatggaacatcacaagtgtatgcaggtcgtgacaacgatactctccgcctt
attgctacattggctttctaa

DBGET integrated database retrieval system