KEGG   Sulfuricurvum kujiense: Sulku_1154
Entry
Sulku_1154        CDS       T01370                                 
Name
(GenBank) outer membrane porin
Organism
sku  Sulfuricurvum kujiense
SSDB
Motif
Pfam: OprD Campylo_MOMP
Other DBs
NCBI-ProteinID: ADR33817
UniProt: E4TWX6
Position
complement(1149416..1150786)
AA seq 456 aa
MTKLSLAAALLLGSAVFASAADNLVSAFKEGKLDGRLRAQYFVTDWDNDAKYSATGFAVG
GSLIYKTAPLYGFSFGTGLYTTQNPGGWTDAEDGKNANTSKDLFARGPGSAYDYGDGYAV
LAQAYLQYDIAKSKIRAGRMLVSNPWMSPNDTKMIPVAFEGVDFVSNDLLNTTVQLDYID
KIKERGMDYFGNMAETLDTPSKISSYYDTGYGTATHRHGDAPDVTVFGIKNRSFDNLELE
GWVMHWPDLVDHLRLEANYAFEAGDVILGLGGLYMQQYDKGAGDIILPKTNNYDSDNSVD
TNLWALRATANYRAAKFLLATSHTDSGADMIAPWRGFPTQGYTRSMTQTDWNANTTAYKA
EFDYDFDAIVAGMSTMLSYAYYDRDPSKKPYQSMTDRAFGNGDTHQWNFDILYKLAGDWK
GTELKARLMDQNNDKTALATAETSNQEMRLEINYRF
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgacaaaacttagtttagcagcagcattgctcttgggatcggcagtatttgcatcggca
gcggataatctagtcagtgcttttaaagaaggaaaacttgacgggcgcctcagagcccaa
tattttgtgaccgattgggataatgatgcaaaatacagtgcaacaggctttgccgtcggc
ggaagtttgatctataaaacagcaccattgtacggttttagtttcggaacaggtctttat
accactcaaaatccgggtggatggacagatgcggaagacggcaaaaatgccaatacctcc
aaagacctgtttgcacgaggcccgggttctgcctacgattatggcgacggatacgccgtt
ttggcacaggcctatttgcaatacgacattgccaaaagcaaaatcagagcgggccgcatg
ctggtaagtaatccgtggatgtcgcccaacgacaccaagatgatcccggttgctttcgaa
ggggttgattttgtttcaaatgatctccttaacactaccgttcagttggactatatcgat
aaaatcaaagaacgcggtatggactatttcggaaatatggccgaaacgctcgatactcct
tctaaaatcagttcgtattacgataccggctacggtaccgctactcatagacacggagac
gctccggatgtcaccgttttcggtatcaaaaaccgttcattcgacaaccttgaacttgaa
ggatgggtcatgcattggccggatctggtagatcatcttcgtctggaagccaattacgcg
tttgaagcgggtgatgtgatcctcggactcggcggtttatatatgcagcaatacgacaaa
ggggccggggatattatcttgcctaaaaccaataactacgacagtgataacagcgtcgat
accaatctttgggctttaagagctacggcaaattaccgtgcagcaaaatttctgctagcg
acatcacacacggacagcggtgcagatatgattgccccgtggcgcggattcccgacccaa
ggctatacgcgaagcatgacgcaaaccgattggaatgccaatactacggcatataaagca
gagtttgattatgactttgatgccatagtagcgggtatgagtacgatgctcagctatgcc
tattacgatcgtgatccgagcaaaaaaccgtatcaaagcatgacggatagagccttcgga
aacggggatacccaccaatggaatttcgatattctctacaaacttgccggagactggaaa
gggacggaactcaaagcccgtttgatggatcaaaataatgataagacagctttagcgaca
gctgaaacatcgaatcaggaaatgcgtttggaaatcaattaccgtttctag

DBGET integrated database retrieval system