KEGG   Sulfuricurvum kujiense: Sulku_1662Help
Entry
Sulku_1662        CDS       T01370                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00480  Glutathione metabolism
sku00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sulku_1662
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sulku_1662
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sulku_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADR34323
UniProt: E4U0K6
Position
complement(1674665..1675204)
Genome map
AA seq 179 aa AA seqDB search
MKKKWWLGAWVITVLALLLNAASIYKYEVKTLRNETTTLEPYRGKVLLIVNIASRCAYTP
QLGGLEKLYSTYSSRGFAVLGFPTNQFSSQEPLAGPELEKFCKLKYGVTFPIFGKIDVSG
VNINPLYHYLKNGISGVSQSEPIEWNFTKYLIDRNGFVLRKYSPRVKPEEIAADIEKFL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatggtggcttggagcatgggtaattacagtacttgcattgttgctgaat
gccgcatccatttataaatatgaagtcaaaacacttcgcaatgagacaacaacactggaa
ccgtataggggaaaggtcttgttgatcgtcaatattgccagccgatgcgcttatacccct
caactcggagggcttgaaaagctgtacagtacatatagttcccgcgggtttgcggtactc
ggatttcctaccaatcagttttcatctcaagagccgttggcggggccggaacttgagaaa
ttctgcaagctcaagtacggggtaacgtttccgatattcggaaaaatcgatgtcagcggg
gttaatattaatccgctttaccattatctaaaaaacgggatatcaggggtaagtcaaagt
gaaccgatagagtggaattttaccaaatacctgatagatcgtaacggatttgtgcttcgc
aaatattctccgagagtaaaacccgaagagattgcagcggatatcgagaagtttttgtaa

DBGET integrated database retrieval system