KEGG   Sulfuricurvum kujiense: Sulku_1995Help
Entry
Sulku_1995        CDS       T01370                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00860  Porphyrin and chlorophyll metabolism
sku01100  Metabolic pathways
sku01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sku00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulku_1995
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Sulku_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ADR34655
UniProt: E4U2G8
Position
complement(2009390..2010757)
Genome map
AA seq 455 aa AA seqDB search
MLDFDKFTKYSKPGPRYTSYPTALEFSESFDYDAYLSKLHSQDPSRELSLYFHLPFCKNA
CYFCGCNVVFTSKEDKKERYIDYLTRELQILSTHIDVNRPVIQLHFGGGTPTFFDADQLH
RIITAIKSHFKNFAEGAEISCEIDPRHIDEAQMKVLSDAGFNRVSFGIQDFDDKVQVAVH
RVQPYDITKTAMELARKYNMVSVNVDLIYGLPHQSLETFKKTLDLAISLDPDRFAVFNYA
HVPWLKKTMRKIDETTLPHPAEKLSIMRYTIDHMEERGYKMIGMDHFAKPEDELFKAIEK
GELHRNFQGYTTKGGADLIGIGLTSIGEGADYYAQNFKDMESYEAAIDAGKLPHERGVAL
NEDDRIRQYVIMELMSNFKLDISRFERLYGVKFAEYFADAVEALKPFEADGLLTITPSSI
ECSTTGTLLIRNIAMPFDAYMKRHASSDKAFSKTV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattttgacaaatttaccaaatattcgaagccggggcctcgttatacgagctat
ccgactgcattggaatttagcgagagttttgattacgacgcgtatctctcaaaacttcat
tcgcaagatccgtctcgagaattatccctctattttcacttgccgttttgtaaaaatgcc
tgctatttttgcggatgcaacgttgtctttacctccaaagaggacaaaaaagagcgatat
atcgattatttgacgcgcgaacttcaaattttgagtacccatatcgatgtgaaccgtccg
gtgatccagctccatttcggagggggaaccccgacgtttttcgatgccgatcagcttcac
cgtatcatcacggcgatcaaaagccattttaaaaattttgccgaaggggcggagatcagc
tgtgagatcgatccgcgccatatcgatgaagctcagatgaaagttctcagcgacgccggt
tttaaccgtgtcagtttcggtattcaggattttgacgacaaagttcaagtggcggtacac
cgtgttcagccttatgacatcaccaaaacggcaatggagctggcacgaaaatacaatatg
gtcagcgtcaacgtcgatttgatttacgggctgccgcatcaaagtctggagacctttaaa
aagacccttgatttggctatttcgctcgatccggatcgatttgccgtctttaactatgcc
cacgtgccgtggctgaaaaagacgatgcggaaaatcgatgagacgacattgcctcatccg
gccgagaaactctctatcatgcgctatacgatcgatcatatggaagagcgcggctataag
atgatcgggatggaccattttgctaaacccgaagacgaacttttcaaagcgattgaaaaa
ggggagcttcaccgtaactttcagggatatacgactaaagggggtgccgatctgatcggt
atcggcctcacatccatcggcgaaggggctgattattacgcccagaatttcaaagatatg
gaaagctacgaggccgcgatcgatgcgggaaaattgccgcatgagcggggtgtggcgcta
aacgaagatgaccgtatccgccaatatgtcattatggaactgatgagtaatttcaagctc
gatatttcccgatttgaacgattgtacggcgtgaaatttgcagagtattttgccgatgcg
gttgaggcactcaagcctttcgaagcggacggcttgcttacgataacgccatcatcgatt
gaatgttcgacaacggggacgctgttgatccgaaatatcgccatgccgtttgacgcctat
atgaaacgtcacgcctcttccgataaagcattcagtaaaacggtgtaa

DBGET integrated database retrieval system