KEGG   Sulfuricurvum kujiense: Sulku_2063Help
Entry
Sulku_2063        CDS       T01370                                 

Definition
(GenBank) NADH/Ubiquinone/plastoquinone (complex I)
  KO
K14086  ech hydrogenase subunit A
Organism
sku  Sulfuricurvum kujiense
Brite
KEGG Orthology (KO) [BR:sku00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Sulku_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Proton_antipo_N
Motif
Other DBs
NCBI-ProteinID: ADR34723
UniProt: E4U2V9
Position
complement(2075195..2076961)
Genome map
AA seq 588 aa AA seqDB search
MSMVLTLVLLPIIASLFLQLAPNSRVQYVISAAVLIVLSFTAFSLNVSADILTFHLPRSL
NVFIIAADVALLLFFLYQGKKFNNTKVIFLAAVQLLLYGYIESIVPEGGTAEIVVDSLSK
FMFLIINGVGGIIVLYSVRYMEDEPASPVRKRFFIGALLVFLSVMNLIVCANSILLFFFL
FEMTTLASYVLIAFRNDEVSRANALKALWMNQIGGVVILLGAWVAVSEFDTVMFDTLLQR
SSGLVLLAVAFLAMAALVKGASIPFEGWLLGAMIAPTPVSAMLHSATMVKIAPYLILKLA
PALASTMVGGIISIIGALVFIAASYLALSRSVFKEILGYSTVALLGLMMALAAIGTEESM
NLAMVLILFHALSKALLFLSAGVLEKQHHAKNIEEMKGMVVHSPQTVGFILFGFMSLTLP
PFGLFMGKLFAITSVASLLKEHPSYIIVLLSLIIGSAVLVLLYFKVASALLSAPSDIAPS
ESIPIPAGYNIPLVLLVLSIIIGAVGYIMIQQNIFVVLLALPILFVFALPSIFRQMDGYD
RSQPYHCGEKEMFDSALVYYEPSERIRQALYWGFGVLFVGVAVVGALS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggtattgacacttgttttattgccgatcatagcttcgctttttttacaatta
gcgccgaatagccgagtacagtacgttataagtgccgctgttttaatcgtgctgagcttt
accgctttttccctaaatgtctctgcggatattttgacctttcatcttccccgctccctc
aatgtttttattattgctgccgatgtcgcgctgctgctgttttttctttatcagggtaaa
aagttcaacaatacaaaagtgatatttcttgccgctgtgcagctgctgctgtacggatac
attgaatccatcgttccggaagggggaacggcggagatcgttgttgatagcctctccaaa
tttatgtttttgattattaacggggtgggggggattatcgtcctttattccgtgcggtat
atggaggatgaacccgcatctccggttcgaaaacggttttttatcggggcattgctggtt
ttcctttctgtaatgaatctgattgtttgcgccaactcgattctccttttcttttttctg
tttgagatgacgacgctggcatcgtatgtgctgattgcgtttagaaatgatgaggttagc
cgtgccaatgctcttaaagccctatggatgaatcagatcgggggtgtggtcattttactt
ggggcatgggtcgcggtttcggaatttgatacggtaatgtttgatacgctgctgcagcgc
tcaagcgggctggtactgttggcggttgcgtttttggcaatggcggctttggtgaaaggg
gcgtccatcccttttgaagggtggctgctcggggcgatgatagcgccgactccggtgagt
gcgatgctccattcggcaacgatggtaaaaatcgctccctatcttattttaaaacttgca
ccggcgctagcttctacaatggtaggagggatcatttcaataatcggagctttggtattt
atagccgcttcgtatctggcattgtccaggtcggtgtttaaagaaattctaggttattcc
accgttgctttgctggggttgatgatggcgcttgccgcgatcggcacggaagagagcatg
aatctggcgatggtattaatattgtttcatgccttatctaaagcacttctcttcctctca
gccggagtactggaaaaacagcatcatgccaaaaatattgaagagatgaaggggatggtg
gtacactctccgcaaacggtaggttttatcctttttggatttatgtcactcactcttccg
ccgttcggtctttttatggggaagctttttgcgattacatcggtggcatcgctcttaaaa
gaacacccctcctatattatcgttttgctttcgctcattatcggcagtgcggtactggtg
cttctttatttcaaagttgcttctgcacttctttcggcaccctcggatatcgccccctca
gagagtattccgatcccggcaggttataatatacctttggtattgcttgtgctttccatt
attatcggagcggtcggatatattatgatacagcagaatatctttgtcgtgttactggca
ttgccgattctgtttgtattcgcattaccctctatatttcggcaaatggatggatatgac
cgctcacaaccctaccactgcggggagaaagagatgtttgattcggcattggtttattat
gaaccctccgagagaatacggcaggcgctgtattggggattcggtgtcctttttgtcggg
gtagcggttgtaggagcattgtcatga

DBGET integrated database retrieval system