KEGG   Sulfuricurvum kujiense: Sulku_2330Help
Entry
Sulku_2330        CDS       T01370                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00010  Glycolysis / Gluconeogenesis
sku00020  Citrate cycle (TCA cycle)
sku00620  Pyruvate metabolism
sku00633  Nitrotoluene degradation
sku00640  Propanoate metabolism
sku00650  Butanoate metabolism
sku00680  Methane metabolism
sku00720  Carbon fixation pathways in prokaryotes
sku01100  Metabolic pathways
sku01120  Microbial metabolism in diverse environments
sku01130  Biosynthesis of antibiotics
sku01200  Carbon metabolism
Module
sku_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
sku_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulku_2330
   00020 Citrate cycle (TCA cycle)
    Sulku_2330
   00620 Pyruvate metabolism
    Sulku_2330
   00640 Propanoate metabolism
    Sulku_2330
   00650 Butanoate metabolism
    Sulku_2330
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Sulku_2330
   00680 Methane metabolism
    Sulku_2330
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Sulku_2330
Enzymes [BR:sku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Sulku_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADR34990
UniProt: E4TXQ4
Position
complement(2346021..2347241)
Genome map
AA seq 406 aa AA seqDB search
MADTMELRDIEVWDGNMAASHALRQVQVDVVAAYPITPSTPIVENYAGFTANGYVDGEFV
MTESEHGAMSCCIGAAAAGGRVATATSSQGFALMVETLYSASGMRLPIVLNVVNRAIGAP
LNVNGDHSDMYMGRDSGWIQLDSYCPQEAYDLNFIAFKVSEDHDVRLPAMVHQDGFMTSH
TAQGVHTLTDEAAYNFVGEYKPMNDMLDLDHPVTHGVQTEEDWHFEHKARQQHALMTAVF
PKIEAAFAEFEKLTGRKYNLVEKYSMDDAEVAVVCMGTSVETAREVALEMRQNGIKAGVV
GIRVFRPWPLEQIAAALKDVKAIAALDRSSPHGTVGALFNEISGSLFNTDTKAVLTNYIY
GLGGRDLTKAHLVSIFTDLKANADAGKPTTPMQQYIGLRGPKLSFF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacaatggaactacgcgatatcgaggtttgggacggtaatatggcggcaagc
catgcacttcgccaagtgcaagtggatgttgttgccgcttacccgattactccctcaacc
cctatcgtagaaaattatgcaggatttacggcaaacggctatgttgatggcgagtttgtt
atgaccgaatctgaacacggtgctatgtcatgctgtatcggtgcggcggctgcaggcggt
cgtgtagctacagctacaagttcacaaggtttcgcattgatggtagagaccttgtactct
gcatcaggtatgcgccttccgatcgttctaaacgtcgtaaaccgcgctatcggtgcaccg
ttgaacgttaacggcgaccactctgatatgtacatgggacgcgacagcggttggattcag
cttgactcatactgcccgcaagaggcgtatgacttgaatttcatcgctttcaaagtctct
gaagaccatgatgtccgtttaccggcaatggttcaccaagacggatttatgacctctcac
acggctcaaggggttcatacccttaccgatgaagcggcatacaacttcgtcggcgaatac
aaaccgatgaatgatatgctcgatcttgaccatccggtaacgcacggggttcaaacggaa
gaagattggcatttcgaacacaaagcgcgtcaacaacacgctttgatgacggcagtattt
ccaaaaatcgaagcggcgttcgctgaatttgaaaaattgacgggccgcaaatacaacctt
gtagaaaaatacagtatggacgatgcggaagtagcggttgtctgtatgggaacttcggtt
gaaacggcacgtgaagtagctcttgaaatgcgccaaaacggtattaaagcgggtgtcgtc
ggtatccgcgttttccgtccgtggccattagaacaaatcgcggctgcattaaaagatgtg
aaagcgattgccgcattggatcgttcaagcccgcacggtactgtcggagcacttttcaat
gagatctccggatcattgttcaatacagacacgaaagcggtattgacaaactacatctac
ggattgggcggacgtgacttaaccaaagcacacttagtgagtatctttacagatcttaaa
gcaaatgcggatgcgggcaaaccgacaaccccaatgcaacaatatatcggtcttcgcggg
ccgaaactctcttttttctaa

DBGET integrated database retrieval system