KEGG   Serpula lacrymans: SERLADRAFT_344479Help
Entry
SERLADRAFT_344479 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sla  Serpula lacrymans
Pathway
sla03040  Spliceosome
sla04141  Protein processing in endoplasmic reticulum
sla04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sla00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SERLADRAFT_344479
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SERLADRAFT_344479
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SERLADRAFT_344479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sla01009]
    SERLADRAFT_344479
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sla03041]
    SERLADRAFT_344479
   03009 Ribosome biogenesis [BR:sla03009]
    SERLADRAFT_344479
   03110 Chaperones and folding catalysts [BR:sla03110]
    SERLADRAFT_344479
   04131 Membrane trafficking [BR:sla04131]
    SERLADRAFT_344479
   03051 Proteasome [BR:sla03051]
    SERLADRAFT_344479
   03029 Mitochondrial biogenesis [BR:sla03029]
    SERLADRAFT_344479
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sla04147]
    SERLADRAFT_344479
Protein phosphatases and associated proteins [BR:sla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SERLADRAFT_344479
Spliceosome [BR:sla03041]
 Complex B
  Other components
   Prp19 complex
    SERLADRAFT_344479
 Complex C
   Prp19-CDC5 complex
    SERLADRAFT_344479
Ribosome biogenesis [BR:sla03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    SERLADRAFT_344479
Chaperones and folding catalysts [BR:sla03110]
 Heat shock proteins
  HSP70 / DNAK
   SERLADRAFT_344479
Membrane trafficking [BR:sla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SERLADRAFT_344479
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SERLADRAFT_344479
Proteasome [BR:sla03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SERLADRAFT_344479
Mitochondrial biogenesis [BR:sla03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    SERLADRAFT_344479
Exosome [BR:sla04147]
 Exosomal proteins
  Proteins found in most exosomes
   SERLADRAFT_344479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 18809016
NCBI-ProteinID: XP_007312257
JGI: 344479
UniProt: F8NE44
Position
Unknown
AA seq 115 aa AA seqDB search
EIVLVDGSTCIPCIVKLVSDFFNGKEPINPDKAVAYGAAFQAAIFSGDTSEKTQDLLLNV
SPLSLGIETTGGIMTALIKHNTTIPTTKLETFSTYSPGVLTEVYKGERAHRHISH
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gagattgttttggtcgatggttctacttgtatcccttgtattgtcaaacttgtgtcagac
ttcttcaatggcaaggagcccatcaaccctgacaaagctgttgcctacggtgctgctttt
caggccgcaattttttctggtgacacttctgagaagactcaggacctcctcctcaatgtg
tctcccttgtcgcttggtattgagaccactggtggtatcatgactgccctcattaaacat
aatactactatccccaccacaaagttggagactttctccacttactcgcctggtgtcctc
accgaagtgtacaagggtgaacgtgcacacagacacatatcacactaa

DBGET integrated database retrieval system