KEGG   Serpula lacrymans: SERLADRAFT_348482Help
Entry
SERLADRAFT_348482 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
Organism
sla  Serpula lacrymans
SSDB OrthologParalogGFIT
Motif
Pfam: DUF747
Motif
Other DBs
NCBI-GeneID: 18809177
NCBI-ProteinID: XP_007317937
JGI: 348482
UniProt: F8NU49
Position
Unknown
AA seq 594 aa AA seqDB search
MDRHRGCDRHSIKSRDHSISLERSRPLIYASLPPTPILPSPPASPPPHNRVPPPPAAEPH
QPLFSLWDYLREELLATDFDSHQELKWERVSNFLSIPLAIEKIIGFGFILCLDSFLYTFT
ILPIRFALAAFRFAANLVTFSKSHLPPSQKADIMRMLLLLVSVTILLPLTDASKIYHSIR
GQDTIKLYVIFNALEIADRLCASIGQDILDCLFSRSTLEVLTHRLPVTSHTLRPFFFFAL
AVLYTVAHALVMVYQLLSLNVAVNSYDHALLTLLMSNQFVEIKGSVFKKFEKDNLFQITC
ADIVERFTLTLMLFVVAFRNLIELSGSEFDFTDGFSLPKSFGWFRGNNVLWTISYPVLTV
MASEMLVDWLKHAFITKFNHIRPSVYERYTDVLCRDLASGSAAGRLGARKHAYVDQSPLV
ARRLGFASLPLAVLAIIIGLQSLNLVFSLDFDFTYEEWNLETVRALSSEEIVHLAKWAVM
GVAFWLCFLAVKILLGVNLISYANRRRAGMEARAAADVVNDFGRDPIGEGREEKEYNKQL
KKMVDDWRDNAAVVGEMGEARGPKNGNGREKADGGKKRVELEDLTRFTMVKRIW
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcatcgtggatgtgatcgacattcaatcaaatcaagagaccatagcatctct
ctagagaggagtaggccattgatatacgcgtctctaccccctacacctatcctaccctct
ccacctgcgtctccacctccccacaatcgagtaccgccccctccagccgcagagcctcat
caacctttgttttcgctatgggactatcttcgagaagagcttttggctacagatttcgat
tcacatcaggaactcaaatgggaacgggtcagcaattttttgagtattcctctggctata
gaaaagataataggttttggcttcatcctatgtttagactcattcctgtacactttcacc
atattacctattagattcgcactcgccgcattccgtttcgctgcaaaccttgttacattt
tccaagtcacaccttcctccctctcaaaaagccgacattatgcgcatgttgctcttgtta
gtctccgtcacgattctccttccactaacggatgcaagcaagatctaccactctatccgt
gggcaagatactatcaaactatatgtcatcttcaacgcgcttgaaatcgccgaccggctg
tgtgcgtccataggtcaagacatccttgattgcttattttcacggtccaccctggaggtg
ctcacacacagacttcccgtgacgtcccatactcttagacctttcttcttctttgcactc
gcagtcttgtacacagttgctcacgcactggtcatggtctaccagcttctctccctaaac
gtcgccgtcaactcttacgaccacgcgctcctcactctcctcatgtctaatcagtttgtc
gagataaagggcagcgtgttcaagaaatttgagaaggataatctctttcagatcacctgt
gcagacatcgtagagcgcttcacgctcacgctcatgctcttcgttgtcgcgtttcggaac
cttattgagctgagcggatccgagtttgactttacggatggtttttcccttccaaagagt
tttggatggttccgtggaaataacgtcctttggacgatctcgtatcctgtactcaccgtg
atggcgtcagagatgcttgtcgattggctcaaacatgcgttcatcaccaagttcaatcac
atccggccgtctgtatacgaaagatacacagacgtcctatgtcgggatctggcgagtggt
agcgccgctggcagattgggcgctcgcaagcacgcttacgttgatcaatctcccctagta
gctcgtcgacttggattcgcatccctccccctcgcagtcctcgccatcatcatcggtctc
caatctctcaacctcgttttctcccttgactttgattttacttacgaggaatggaatctc
gaaaccgtaagagccttgtcaagcgaagagatcgttcatctggccaagtgggcggtgatg
ggtgtagctttttggctttgttttcttgcggtaaaaatactcttgggggtgaatcttatc
tcttatgcaaaccgaagacgcgctgggatggaagcacgggctgcggcagacgtagtgaac
gattttggacgcgatccaattggagaagggcgagaggagaaggaatataataagcagttg
aagaagatggtagacgattggcgggataacgccgctgtagttggagagatgggagaagca
agggggcctaagaatggcaacggtagagagaaagcagacggtggtaagaaaagggtcgag
ttggaggatctcacacgttttactatggtcaagcggatttggtag

DBGET integrated database retrieval system