KEGG   Serpula lacrymans: SERLADRAFT_355394Help
Entry
SERLADRAFT_355394 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
sla  Serpula lacrymans
Pathway
sla00780  Biotin metabolism
sla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SERLADRAFT_355394
Enzymes [BR:sla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     SERLADRAFT_355394
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     SERLADRAFT_355394
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     SERLADRAFT_355394
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     SERLADRAFT_355394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 18809471
NCBI-ProteinID: XP_007316880
JGI: 355394
UniProt: F8NR60
Position
Unknown
AA seq 689 aa AA seqDB search
MNVLVYADVQSPEIHQTITTLKRILVPHYTVQPISTDSLLTQPWQPSCALFVLTASPTRH
QEATSLTGNAAGVVEKYVESGGSVLGLGYDVGKSGSAPGFGSDLSMLRDGKQFRLHDKKS
GNTVYPRSFSPSTETPSTHVHILESGTTLALPVHSSSPQPNSESEFESEVTNLENMSNLT
VLARFEPSNAIAGLQMSIGSGKAAFWAERVDLPSTITSPDAAFVSSVPSNGSQAQEQIRP
LLPALTHALQSLGILVPASDVHPSNASKPATITSKPTLSHPLPQFLFSRPKEPEIVQDFI
RALFPASHSTTGKSPQVLEDTDDTFYFHMAEKGEKIWLMFTSAPLRTKHIILSLPPSSYT
PLFDSSVFFEALQDARVEVNALDDNTPDNGWSLGDLLLYGPLVTSTQTMFDKNPRFLSGH
PVPLLSIASYQLQGRGRGKNEWVSPGGCLMMSFSLRAALGPQFGANRLVFVQYLAALAVV
EGVRAVFKALGSGTSSTASSARLSSGLADKVKIKWPNDIYVELDTEKGVERKKIGGVLVN
SSFGGGKVDIVVGIGLNVLSLPPLASIAQLLPPDLRPDKVHTAASIIATFDVMWTDFLNN
GGSFDPFMELYLKRWMHSDQIVTLTTTTPPTIVRIVGITPDHGLLRTIPERVGFGLGSGG
GESEGGRYIDLQPDGNSFDLMAGMIRVKA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttagtatacgccgacgtccaatcgcctgaaatccaccagactatcacaacg
ctcaaacgtattcttgttccgcattacaccgttcagccaatctcgactgactccttgctc
acgcaaccctggcagccatcctgcgcgctcttcgtacttacagcctccccgactagacac
caagaggcaacctcgctgacaggaaatgcagcgggagtggtggaaaagtatgtggaatct
ggaggatctgtgctcggattagggtatgatgtaggaaagagtggatcagcacctggattt
ggatctgatctgagtatgctgagagacggcaagcaatttaggctgcacgacaaaaagtcg
ggtaatactgtctaccctcgttcgttctctccttcaactgagacgccttcaactcatgtt
cacatccttgaatcgggaactacgcttgcactccctgtgcattcttcctctccacagcct
aacagcgaatccgaatttgaatcggaggtcacaaacctcgagaatatgtccaatctcact
gtccttgcacgtttcgagccatcaaacgcgatcgctggccttcaaatgagtattggaagc
ggaaaagctgcattttgggctgaaagagttgatttaccttctactataacgtcgccggat
gctgcttttgtgtcttctgtcccgtccaacggatctcaagctcaagagcagattcgtccg
ttacttcctgctcttactcatgctctccaatccctcggaatactcgtccccgcttcagac
gtgcatccttccaatgcatccaaaccagcaacgataacttcaaaacccacgttatcacac
cctcttccccagtttcttttctcgcgtccgaaggaacctgaaatagtccaagatttcatc
agagcacttttccctgcgtctcactctactacaggtaaatccccgcaggtgttagaagac
acggatgatacgttctacttccacatggctgaaaaaggtgagaaaatatggctgatgttc
acctcagccccccttcgaactaagcacatcatcctttctctccccccttccagttacacc
cctctcttcgattctagtgtcttctttgaggcactacaggacgcaagggtggaagtaaat
gctctcgatgataatactcctgacaacggctggagcttgggtgacctgctcctctatggt
cccctcgttacgagtacgcagacgatgttcgacaaaaaccctcgctttctctccgggcac
cctgtccctctcctttccattgcctcctatcagcttcaggggagaggtcgtggtaaaaac
gaatgggtatctcctgggggctgtctgatgatgagcttttctttgcgggctgccttgggc
cctcagtttggtgctaatcgtttggtatttgttcaatacctggcggcgcttgccgtcgtt
gagggcgttcgtgcggtctttaaggcgctaggaagcgggaccagtagtactgcctccagt
gctcgtttatccagtggactggcggataaggtgaaaataaagtggccaaatgatatttat
gtcgaactcgataccgagaaaggagtggagaggaagaagattgggggcgttcttgtgaat
tcaagtttcggaggtgggaaagtagatattgttgtcgggattggcctgaatgttctttcc
cttcctccccttgcctccattgcacagctgttaccacccgatttaaggccagacaaggtg
cacacagccgcctcgatcattgctactttcgacgtgatgtggaccgactttttgaataat
ggaggctcgttcgatccgtttatggaactttacttgaagaggtggatgcattccgaccaa
attgtcacactgacgacaactactccgcctacgattgtccgtattgttggaatcactcct
gatcacgggcttctaaggaccattccggagcgggtagggtttggtctaggttctggagga
ggggagtcagaaggagggagatatatcgacctccagcccgacgggaatagtttcgatcta
atggcgggtatgatacgcgtcaaggcttag

DBGET integrated database retrieval system