KEGG   Serpula lacrymans: SERLADRAFT_359366Help
Entry
SERLADRAFT_359366 CDS       T03135                                 

Definition
(RefSeq) glycoside hydrolase, family 1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
sla  Serpula lacrymans
Pathway
sla00460  Cyanoamino acid metabolism
sla00500  Starch and sucrose metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SERLADRAFT_359366
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SERLADRAFT_359366
Enzymes [BR:sla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SERLADRAFT_359366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 18809672
NCBI-ProteinID: XP_007314335
JGI: 359366
UniProt: F8NHP3
Position
Unknown
AA seq 484 aa AA seqDB search
MTDKKLPKDFTWGFATASYQIEGSYNEGGRAPSIWDTFTRIPGKIADGSSGDVATDSYKR
WKEDVALLKSYGVNSYRFSLSWSRIIPLGGRGDKVNPEGIAFYRGIIEELVKNGITPYLT
LYHWDLPQELHDRYGGWLNKDEIVKDFVNYAKICYEAFGDIVKHWITFNEPWCISVLGYG
KGVFAPGRTSDRARSSVGDTATEPYIVGHSVIIAHGYAVKLYRSEYQSAQKGTIGITLDS
SWFEPYDNSKENIAVAQRAFDVRLGWFAHPIYLGYYPEALKKMIGNRLPEFTPEEIAVVK
GSSDFFGLNTYTTHVVQEGGDDEFNGGVKQSHKRADGTELGTQGKILYFQRNILLGYIYK
KYGKPIYVTESGFAVKDENKKTVEEAINDTDRVEYYHDYTKGMLEAVTEDGVDVRGYFAW
SLLDNFEWAEGYKIRFGVTYVDYETQKRYPKQSSKFLTEVCLDSLRRTQPRFIHISLQWF
SSHI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagaagttgccgaaggattttacctggggttttgctacagccagttaccag
attgaaggttcatacaacgaaggtggtcgtgcaccctcgatctgggataccttcacaaga
attccaggaaagatcgcggatgggtcttctggagacgttgcaaccgactcctataagagg
tggaaggaagatgttgcgcttttgaagtcatatggtgtcaattcatatcgtttctcattg
tcgtggtctcgaattatccctctcggcgggaggggagacaaggtcaacccggaaggaata
gcattctacaggggtataatcgaggaattggtgaagaatggtatcacaccttatttgacc
ttgtatcactgggatttacctcaggaactccatgatcgctacggaggctggctgaataag
gatgagattgtcaaagactttgtcaactatgcgaaaatctgctatgaagcttttggtgat
attgtcaaacactggatcactttcaatgaaccatggtgtatttccgttctcggatatggc
aaaggcgtattcgccccaggacgaacgagtgacagggctcggtcttccgtaggagatact
gccactgaaccatacattgtagggcacagtgtgatcatagcacatgggtatgcggttaaa
ctttatcgctcagaatatcagtccgcgcaaaaaggtaccatcggaatcacactagacagt
agctggtttgagccctacgacaatagcaaagaaaacatcgcagtagcgcagcgcgcgttt
gatgtgaggctgggttggttcgctcatccgatctatctgggttattaccctgaagccctc
aagaagatgattggtaatcgtcttccggagtttactccggaggaaatagcagtggtcaag
ggctcctccgattttttcggtttgaatacatataccacacatgtcgtccaggaaggtggt
gatgatgaatttaacggcggtgtcaaacaatcgcacaagcgcgctgatggaacagaatta
ggaacccaaggtaagatcctatatttccaaaggaacattttacttggttacatctacaag
aaatacggcaagccgatatatgtcacagaaagcggctttgccgtcaaggatgagaacaaa
aagacggtcgaagaagcaataaatgatactgacagagtcgaatattaccacgactacacg
aaaggcatgctcgaggcggttactgaagatggtgtagacgtcaggggttatttcgcttgg
agtcttttggataactttgaatgggcggaaggttacaagatacgctttggtgtgacttac
gtggactacgagacgcagaaacgctaccccaaacaatcatccaagttcttgactgaggta
tgtcttgactctttgagaagaacccaaccgaggtttatacatatttcattgcagtggttt
tcttcgcatatctaa

DBGET integrated database retrieval system