KEGG   Serpula lacrymans: SERLADRAFT_360933Help
Entry
SERLADRAFT_360933 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
sla  Serpula lacrymans
Brite
KEGG Orthology (KO) [BR:sla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sla01001]
    SERLADRAFT_360933
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sla03036]
    SERLADRAFT_360933
Enzymes [BR:sla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SERLADRAFT_360933
Protein kinases [BR:sla01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   SERLADRAFT_360933
Chromosome and associated proteins [BR:sla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    SERLADRAFT_360933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 18809807
NCBI-ProteinID: XP_007317108
JGI: 360933
UniProt: F8NSF7
Position
Unknown
AA seq 285 aa AA seqDB search
MELERSMQDDHFLCFAMELMQHDLMEVMMDDPCACRVNARRWSAQITLGIASLHEMGIIH
RDIKPENVLVDARGNARIADLGAAYMHSGALHWWGEYSIDLVGTWQYMAPEVIQNKGLPK
RDKKSYGIAVDYWALGCLIYELESDDHDTLFNSDMGCAGYLAWRSSHFGVVYPPLQSLNK
DAASVITGLLRTAPGYRFGIRDLRRHAYFRTEAGMSEFADTEARALARPINPDFQPHLMR
STYTSELIFTPVRCSRHSKLGGEADFSRFDWDNPRSGVVVDSSIN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaactggagaggtcgatgcaggatgatcattttctctgctttgcaatggaattaatg
caacacgatttaatggaagtcatgatggatgatccatgtgcatgccgagttaatgcgcgg
aggtggtccgctcaaataactctaggaattgcctctttacacgagatggggatcatccat
cgcgacattaaacctgaaaacgttctcgtcgacgcgaggggcaacgcccgtatcgccgac
ctcggcgcggcgtacatgcactccggtgctcttcattggtggggggaatatagcatagat
ctcgtagggacctggcagtacatggcccccgaggttatccaaaacaagggtctcccgaag
cgtgataaaaagtcctatggaatcgcagtggattattgggcgctaggatgtctcatctat
gaattagaatccgatgaccacgacaccctcttcaatagcgacatggggtgcgctggatat
cttgcttggcgatcctctcactttggagtagtatatccaccattgcaaagtctcaacaaa
gatgcagcgagtgtgatcaccgggctgttgcgtacggcgcctggttatcgttttggaatt
cgagatcttagaaggcatgcgtatttccgcacagaagctggcatgtcagagtttgcggat
actgaagcacgggctcttgcacgcccaatcaatcccgatttccagccccacctgatgcgc
tcgacatacacaagcgaactaatatttacgccggttcgatgttctcgacactctaaattg
ggaggggaggccgacttctcgcgcttcgactgggacaacccaagatctggggtggttgtc
gactcgagtataaattaa

DBGET integrated database retrieval system