KEGG   Serpula lacrymans: SERLADRAFT_383000Help
Entry
SERLADRAFT_383000 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sla  Serpula lacrymans
Pathway
sla00740  Riboflavin metabolism
sla00790  Folate biosynthesis
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SERLADRAFT_383000
   00790 Folate biosynthesis
    SERLADRAFT_383000
Enzymes [BR:sla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SERLADRAFT_383000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 18811022
NCBI-ProteinID: XP_007315767
JGI: 383000
UniProt: F8NPB1
Position
Unknown
AA seq 322 aa AA seqDB search
MARTRIPTPHGPAFLHLYHNNRDGKEHLAVVIDPAQYSDNTRSSAPPIRSRSLDAVWNET
ETEMDRIIRGAYVGKLSATSQHASNPTSHHSSSTPDSIPSPLVRIHSECFTGETIGSMRC
DCGEQLDEAIRLISQPVPLPKQLSHSLSSTIPGRGAVIYLRQEGRGIGLLSKIRAYNLQD
LGHDTVTANLMLGHKADERGYEVAAAILRDLGLGSELGEGVRLLTNNPDKVQALEKEGLR
VVERVSMIPRSWKQRSTANLDLGVGVETDTEERDQRAAGATMIGGKAVHGHDLDKYLRTK
ILRMGHMLPLYLGDIEDEVKEP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcactcgcataccaacaccacacggccctgcttttcttcacctgtaccacaat
aatcgcgacggaaaagagcacctagccgtagtcattgatcccgcacagtactccgacaac
acgcgttcctcagcaccgccaattcgcagccgctcactagatgcggtttggaacgaaaca
gaaacggaaatggaccgtattatccgcggcgcgtacgtcggaaaactttctgcgacgtca
caacacgcctctaatcccacctcgcatcattcttcctccacacccgactctattccatca
cctctcgttcgtatacactccgagtgtttcacaggggagaccatcggcagcatgcgctgt
gactgcggcgaacaacttgacgaagcaatacgcctcatctcacagcccgttccgctccca
aaacagctttcacacagcctatctagtaccattcctgggcggggcgccgtcatataccta
aggcaggaaggccgtgggattggtcttctctcaaagatacgcgcctataatctgcaggac
cttggtcatgacactgtcaccgcaaatctcatgctcgggcataaggcggatgagcggggt
tatgaggttgcggctgctatcctgcgggaccttggacttgggagcgaacttggggaggga
gtccggctgttaaccaacaatcccgacaaggtgcaggcactagaaaaggagggactgaga
gtggttgagcgagtgtcgatgattcctaggagctggaagcaacgttcgacggctaaccta
gatctcggagttggtgtggaaactgatactgaagagagggatcagagagctgctggtgct
acaatgattggagggaaagctgtccatgggcacgacttggacaagtaccttcgtaccaaa
attctgcgcatgggacacatgcttccgctttacttgggagacattgaagacgaggtcaaa
gaaccatga

DBGET integrated database retrieval system