KEGG   Serpula lacrymans: SERLADRAFT_409365Help
Entry
SERLADRAFT_409365 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sla  Serpula lacrymans
Pathway
sla00564  Glycerophospholipid metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
Module
sla_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SERLADRAFT_409365
Enzymes [BR:sla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SERLADRAFT_409365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 18812818
NCBI-ProteinID: XP_007320039
JGI: 409365
UniProt: F8P0W5
Position
Unknown
AA seq 408 aa AA seqDB search
MPMNQHRGWLPKDPQVLRKWIHAKILQLHRAPVSAPDQYSHPVIAEFHTLIRDDPQAFMY
FTQMSNDEPVGKDGHKNVTDWKMMLCLFDTIIAESIEYHSDQGGQVTVPMNAVINSFMNT
QAGMAAFLYPKINDHFFKVLKVWSNYLASPASRSVLTTNLNGWFSPEAQEERPDFADVFV
CDTSKEFWGFTSWDDFFTRRLRDNVFPVFPDDTRFISNPCESTVYNKGYNVKEQDKFWIK
GQPYSLFHMLNNDPLANQFVGGTVYQAYLSPTDYHRWHSPVTGLIAKTVVVPGTYFAAVP
DDKEGDVLFRSLDFITAVATRALIFVQSDNPEIGLVCFIAVGMGEVSSCEVTVKEGEGIR
KGDQMGMFHFGGSSCCLVFRPETKITFTDEADDGKAVRVNLGIACVAN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgaatcaacaccgcggatggctgccaaaggaccctcaagtcctcagaaaatgg
atacatgcaaagatcttgcagctacacagagctcccgtgtccgctccagaccagtactcc
catcccgtcatcgcagagttccataccctcatccgggacgatccacaagctttcatgtac
tttacacaaatgtcaaatgacgaaccggtcggtaaagacggccacaaaaacgtcacagac
tggaagatgatgctctgtctcttcgataccatcatcgcagaatctatcgagtaccactca
gaccagggtggtcaagtcacggttccaatgaacgccgtcatcaattccttcatgaatacc
caagcaggcatggccgccttcctctatccaaagatcaatgaccacttcttcaaagtactc
aaagtctggtccaactacctcgcttcgcctgcatcgcgcagtgtccttaccaccaatctt
aacggctggttcagccccgaggcgcaggaggaaaggcccgattttgccgatgtctttgtt
tgtgatacgtccaaggagttctggggattcacctcttgggacgatttcttcaccagacgc
ttgagggataatgtgttcccagtttttcccgacgacaccaggttcatcagtaacccctgc
gagtctacggtctataacaagggctacaacgtcaaggagcaagacaaattttggatcaaa
ggtcaaccatactccctcttccacatgctcaacaacgatccactcgcgaaccaatttgtt
ggcgggacagtttatcaggcttacctgagccctaccgactaccaccgctggcacagtccc
gtcactggactgattgcgaagactgtcgttgtccccggcacttatttcgccgctgtcccc
gatgacaaagagggtgatgtcctctttcgctccctggactttatcaccgcagtggctact
cgtgcattgatttttgtccaatcagacaatccggaaattggcttggtgtgcttcattgcc
gttgggatgggagaggtgtcgagctgtgaagtgacggtgaaggaaggggagggaatcagg
aagggcgaccagatggggatgtttcattttggcggctcgtcgtgctgcctggtctttcga
cctgaaacgaaaataactttcacagacgaggccgatgacggcaaggcagtcagagtcaat
ttgggcattgcatgtgttgcgaactaa

DBGET integrated database retrieval system