KEGG   Serpula lacrymans: SERLADRAFT_437992Help
Entry
SERLADRAFT_437992 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sla  Serpula lacrymans
Pathway
sla00450  Selenocompound metabolism
sla00970  Aminoacyl-tRNA biosynthesis
sla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SERLADRAFT_437992
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SERLADRAFT_437992
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sla01007]
    SERLADRAFT_437992
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sla03016]
    SERLADRAFT_437992
Enzymes [BR:sla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SERLADRAFT_437992
Amino acid related enzymes [BR:sla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SERLADRAFT_437992
Transfer RNA biogenesis [BR:sla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SERLADRAFT_437992
 Prokaryotic type
   Other AARSs
    SERLADRAFT_437992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 WHEP-TRS tRNA-synt_1 DUF1610 DUF1272
Motif
Other DBs
NCBI-GeneID: 18814952
NCBI-ProteinID: XP_007318400
JGI: 437992
UniProt: F8NWH7
Position
Unknown
AA seq 691 aa AA seqDB search
MTQKIRASEDVLRSIPPPGQTSILPKDGETNILITSALPYCNNVPHLGNIIGSTLSADVF
SRYNRTKNRRTLYICGTDEYGTASETQALKEGITPKELCDKYHALHKETYEWFDIGFDHF
GRTPTRQHTEICQSIYTNLGKNGLLEKQVKEQTYCEGCNKFLADRYVEGICPNCGYIDAR
GDQCDGCSRTLDAIDLIEPRCLINKTHSVVPRSSSHMYFRLDATQPRLEDWIRHSWKKGK
WSPNATINADGEIIDARMKGGLRPTPVTRDLTWGVTIPPLGTDDDKEMEGKVLYVWFDAV
IGYASITAEYTPEWKLWWHNQENVQLYQFMGKDNVYFHTIYFPAMQLGDGRPWTTLHHVS
TTEYLNYEGGKFSKSKNRGVFGPAARETGIPASVWRYYLLSTRPETADSMFSWADCIAAN
NNILLNNFGNFVNRLLKFVSSQYDGIIPDGGEAPGPLSPNDELDGEFINEVNSLLRDYTA
AMDSVKIRLGLQTIMLISNRGNNYLQSSKLNKALMTENPQRCAQVVSRAINLIYVLSALI
YPFMPATSDSILVQLNAPARIAPELLSIDILAGHQIGKPEHLFKKIDEKMEDVWKAKFGG
APEATPAVDGAPVSKRKAKKAAVADAKVEVSTTSGPKSPEVIALEAKILEQGQLVRSLKE
QAKEAQVKEKIDEAVTELKRLKTQLVLLEKA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaattagagcttcggaggatgtcttgcggtcaattcctcctccaggacaa
acatccatattaccaaaagatggagaaactaacatcctgatcacttctgcgctgccttat
tgcaacaacgtaccgcatcttggcaatatcatcggaagtacgctaagcgctgatgtcttc
agtcgatataacagaacaaaaaacagaagaacgttgtatatctgcggtaccgacgagtat
ggtactgcatctgagactcaggcactgaaagagggcatcactccgaaggagttgtgcgac
aaatatcacgcactgcacaaagaaacgtatgagtggtttgacattggctttgatcatttc
gggcgaactcctactcgtcagcatacagaaatctgtcaatcgatttatacaaatttaggg
aagaatgggttgctggagaaacaggtcaaagaacaaacttattgcgaaggttgcaacaag
ttcttagcagatcgttatgtggagggaatttgccccaattgtggctatatcgatgcccgt
ggtgaccaatgcgatggctgtagccgaacactagatgctatagatctaattgagcctcgc
tgtttgatcaacaaaacccatagcgtcgttcctcgatcctcttcgcacatgtatttcagg
ttggatgctactcaaccgcgcttggaagactggatacgacattcatggaagaaaggcaaa
tggtcgcccaatgccacgatcaatgcggacggagaaattatcgatgcgcgcatgaaggga
ggtctgaggccgactcccgtaacgagagaccttacatggggtgttacaataccaccttta
ggaacagatgacgataaagagatggaagggaaagtcctttacgtttggttcgatgcagtc
ataggttatgccagtattaccgctgagtatacacccgaatggaagttgtggtggcacaat
caggaaaacgttcaactttaccagttcatgggtaaagacaatgtgtattttcacacaata
tatttccccgccatgcagcttggcgatggacgaccatggacaacgctccatcacgtttcg
acaacagaatatctaaattacgagggaggcaaattttccaagagtaagaatcgtggggtg
ttcggccccgctgccagagagactggtattcctgcttctgtatggcgatattaccttttg
tcaacccggccagagacagcggactctatgttctcctgggcagactgtattgcggccaac
aataatattctgttgaacaacttcggaaactttgttaaccgactcttgaaattcgtctct
tcgcaatatgatggaataatccccgatggtggagaagctcctggacctctatcacccaac
gacgagcttgatggagagtttattaacgaagtcaactctcttctcagagattatacagca
gccatggatagcgtcaaaatcagacttggacttcagacaatcatgttgatatcaaacaga
ggcaacaattaccttcagtcatccaagcttaacaaagcattgatgacagaaaatccccag
cggtgtgcccaggtcgtatcgcgcgccatcaacctgatatacgtgttgtccgcccttata
taccctttcatgcccgccacatcagattccatactagtccaactcaacgcacctgcacgt
attgcccctgaactgctctctatcgatatccttgctggacaccagatcggcaaacctgaa
catttgttcaaaaagattgatgagaagatggaggatgtatggaaggcaaaattcggaggt
gcgccagaagcgacgccagcggttgatggtgcaccagtatcgaaacgaaaggccaagaag
gcagccgttgcggatgcaaaagttgaagtgtccacaacaagcggacctaaatccccggaa
gtcattgcgctggaagcgaagatcttagaacagggacaactggttcgaagtctgaaggaa
caagccaaggaggcacaggtcaaagaaaaaatcgacgaggctgtgacggaattgaagcga
ttaaagactcagcttgttttgttggagaaagcttga

DBGET integrated database retrieval system