KEGG   Serpula lacrymans: SERLADRAFT_449021
Entry
SERLADRAFT_449021 CDS       T03135                                 

Gene name
NiR
Definition
(RefSeq) putative NAD(P)H-nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
sla  Serpula lacrymans
Pathway
sla00910  Nitrogen metabolism
sla01100  Metabolic pathways
Module
sla_M00531  Assimilatory nitrate reduction, nitrate => ammonia
sla_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SERLADRAFT_449021 (NiR)
Enzymes [BR:sla01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     SERLADRAFT_449021 (NiR)
SSDB
Motif
Pfam: Pyr_redox_2 Rieske_2 NIR_SIR Fer2_BFD Pyr_redox Rieske NIR_SIR_ferr Rubredoxin_C NAD_binding_9 AlaDh_PNT_C
Other DBs
NCBI-GeneID: 18816521
NCBI-ProteinID: XP_007318270
JGI: 449021
UniProt: F8NVU0
Position
Unknown
AA seq 1142 aa
MSEAIKSEMITPSCTAPPTIFAIYPCLRGSNLLLDVFSSRRSPRSFIEKLLNLDEANRYR
IVTCGEELHLAYNRVALTDYFQHRSVEKLYLNQFEWYARQDPERFLFHTCEQVTSLDTLG
QNVTTSEGRTINYDYCVLATGSESTLPPYIPPERAERTQGIFVYRNISDLDKILAYSNKD
GVSGGRAVVVGGGLLGLEAAKAVFDLESIAKVAIVNRQAFPLSRQLDNEGGEIVLRRIEA
MGVEVLTKTSVKDITTSPEGIFTGLILSDDTHFEAQMVIFAIGITPRDDLARKSGLTCHD
KGGIIVDGSLKTSADNVYAIGECASWKGNTYGLIAPGIEMADILSFNFTQVETGVGGFRP
RQMNMPDLSTKLKLMGVDVASFGDYFADKGINQQGGKAIPVEVKVDIASLPKVESNKPSA
EKAAPVWEIKIDETANPSGATSKDAAGADKSDRAHIRKRAALGGPVECLTYRDPFAFVYK
KYIFTADGKYLLGGMMVGDTSDYVKLMSLVKKKKVIEVPPSELIIGSGKKGEDDGADLDD
DTQICSCHNVTKAAIADSVKAGVSTLGDLKAKTKAGSGCGGCMPLVTNIFKAEMKKAGHA
VSNNLCPHFAMTRQELFTVIKIRKLKTLTDVMESAGVKKGSIGCELCKPVIGSILSSLYN
EHIMEPAHHANQDTNDRFLANIQRNGTFSVIPRIAGGEITPEKLIALGQVAQKYKLYTKI
TGGQRIDLFGAQKQDLPCIWEELISAGFESGHAYGKALRTVKSCVGTTWCRYGIGDSVGM
AIYLEERYKGIRSPHKLKGGVSGCVRECAEAQSKDFGLIATDKGWNIFLAGNGGSIPRHA
TLFATDVPPSKVIRILDRFLMYYIRTADKLMRTARWVEQFEGGVERLKKILLDDDLGICS
ELEKEMDDLVGSFSDEWATVVKDPVKRRQFRQFANTDERRPLVEEITERGQPRPADWPKQ
FPPAKIHSSAIRVPKAEWRWRRLASVNDLMPSNAGTTSVAVKYGDSQLAIFHIPHKGYYA
TQQMCPHKRAFVLEHGIIGDDADGNLYISCPLHKRNFRLNDGECLNDDEYSIIAFDVKQE
GDELSLLLPEAEDLDAVIGTNKWMVRQATAEAVNRDPDAVQAAEGCGGSGGSCSGGNSSL
EW
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgtccgaggcaatcaagagtgaaatgatcacaccaagttgtaccgctccccccacaatc
ttcgccatctatccttgtctgcgaggttccaacttgctgcttgatgtcttctccagcaga
cgaagcccacgatcatttattgagaagttgcttaacttggacgaagcaaatcgttatcgc
atcgtcacttgcggggaagagttacatctagcatacaaccgagtagccctcacggactat
tttcagcaccgatctgtcgagaagctctatctgaaccaattcgagtggtatgcccgtcaa
gatccggagcggttccttttccacacttgtgaacaagtcacatccttggacactcttgga
caaaatgtcaccacaagtgaaggtcgcacgataaactatgactactgtgtgctcgctact
ggttccgagagcactctgcctccgtatattccaccagagagggcagaaagaacgcagggc
attttcgtttatcgcaatatttctgatctagacaaaatattggcttattccaataaggat
ggggtcagcggcggacgggccgtagttgtgggaggcggattacttggattggaagctgcg
aaggctgtgtttgaccttgaatcaattgcaaaggttgccatcgttaatcgacaggctttc
cccctatctcgtcaactcgataatgaaggaggcgaaattgtactacgtcgtatcgaagct
atgggtgtcgaggttctgaccaagacctccgtcaaggacatcaccacctctcccgaaggc
attttcacaggactcatcctttcagacgatacccattttgaagcccagatggtgatcttc
gccatcggcattactccaagagacgatttagcgagaaagtcaggcttgacgtgtcacgac
aagggtggtattatcgttgacggttccttaaagacgagtgcagataatgtgtatgctatt
ggcgagtgtgcaagctggaaaggtaatacttatggcttgattgcgcctggaattgagatg
gcagacattctctctttcaacttcacccaagtcgagacgggcgttggtggattccgaccc
aggcaaatgaatatgccggacctttctacgaagttgaaattaatgggcgtagacgtcgca
tctttcggagattatttcgccgacaaggggatcaaccaacagggcggcaaggctattcca
gtggaggtgaaagtggacatagctagccttcctaaagtggagtcgaataagccaagtgcg
gaaaaagcggcaccagtctgggagatcaaaattgatgaaactgcaaaccccagtggagcg
acctccaaggacgctgctggcgcagataagagcgaccgcgcccatatacgaaaacgagca
gcattaggaggaccggtggaatgcttgacatatcgcgacccttttgcatttgtttataag
aaatacatatttactgcagatggaaaatacttgcttgggggcatgatggtcggggatacg
tcggactatgtgaaactcatgtcgttggtgaagaaaaagaaagtcatcgaagtaccgcct
tctgagctcatcattggctctggaaagaaaggcgaagacgatggcgctgacctagatgac
gatactcagatctgtagttgtcacaatgtcacaaaagcggcgattgcagattctgtcaag
gctggcgttagcacactcggcgatctcaaagcgaaaactaaagcagggtcaggttgcgga
ggatgcatgcctcttgttaccaacatattcaaggctgaaatgaagaaggcaggccatgca
gtttcaaacaatctatgcccacattttgcaatgacgcgccaagaactttttactgtcatc
aagattcggaaattgaaaactctcactgacgttatggaatccgctggtgtcaagaaaggt
tccataggctgcgagctttgtaaaccagtcataggttctatcctttcatctttgtataac
gagcatatcatggagccggctcaccatgccaatcaagacacaaatgacagatttctcgca
aatatacagcgaaacggaacattctctgtcattcctcggattgcgggaggagagattact
ccagagaagcttatcgcccttggtcaagttgcacagaagtacaagctatataccaagata
accggagggcagcgtattgatctgttcggagcccaaaagcaagacttgccctgcatatgg
gaagagctcatctcagcaggattcgaaagtggccatgcttatggcaaagctctgcgtact
gtcaaatcgtgtgttggcactacttggtgtcgttacgggatcggtgattctgttggaatg
gcaatctatcttgaagagcggtacaaaggtatacgatcgcctcataagttaaagggcggt
gtcagtggttgtgtacgtgaatgtgcggaagcccagtccaaagatttcgggcttattgcg
acagataaaggttggaacatcttcttggctggcaacggtggctctatcccacgacatgcc
accctatttgcgacggatgtaccaccttcgaaagtaattcgtattttggatcgcttcctc
atgtactacatccgcacggctgacaagctcatgcgaaccgcgcgttgggtggagcagttc
gaaggtggagtagaaagactaaagaagatcctcttggatgacgaccttgggatctgctca
gagctcgaaaaagaaatggatgatttggtcgggtcgttctcagatgaatgggctactgtt
gtcaaagatcctgtcaaaaggcggcaattccgccagtttgctaacactgacgaacgacgt
cctttagtagaggaaatcacagaacgtgggcaaccacgtcctgccgattggccaaagcaa
ttccctcctgctaagattcactcttcagctatcagagttccaaaagccgagtggaggtgg
cgcaggctggcgtctgtgaatgacctaatgccctcgaacgctgggacaacatctgtcgct
gtgaagtatggagacagtcagctagcgatctttcacatccctcacaaaggttattatgcg
acgcaacagatgtgccctcataaacgagcatttgtgcttgaacacggcatcatcggcgac
gatgctgatggcaatctgtatatttcatgccctcttcataaacgaaacttccgattaaac
gacggtgaatgtctcaacgatgatgaatattcaattatcgcttttgacgtcaagcaggaa
ggcgacgagctttcgttgctgctgcccgaggctgaagacctggatgcggtcatcgggacc
aataagtggatggtgcgacaggcaacagctgaagctgtcaaccgagaccccgatgccgtt
caggctgcggagggttgtggaggtagcggagggtcatgcagtggtggaaattcgtctttg
gaatggtag

DBGET integrated database retrieval system