KEGG   Serpula lacrymans: SERLADRAFT_451569Help
Entry
SERLADRAFT_451569 CDS       T03135                                 

Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sla  Serpula lacrymans
Pathway
sla00230  Purine metabolism
sla00240  Pyrimidine metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
sla01130  Biosynthesis of antibiotics
Module
sla_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sla_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sla_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SERLADRAFT_451569
   00240 Pyrimidine metabolism
    SERLADRAFT_451569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sla04131]
    SERLADRAFT_451569
Enzymes [BR:sla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SERLADRAFT_451569
Membrane trafficking [BR:sla04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SERLADRAFT_451569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 18816749
NCBI-ProteinID: XP_007321833
JGI: 451569
UniProt: F8P4J4
Position
Unknown
AA seq 152 aa AA seqDB search
MASVKERTYIMVKPDGVQRNLVGEIIGRFEKRGFKLTALKLVHASPEHLEKHYADLAGKP
FFPGLIKYMASGPVVAMVWEGLDAVKTGRVMLGATNPLQSPVGSIRGDFALAVGRNICHG
SDSVENAEKEIKLWFPEGTIQYSLAQESMIYE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgtaaaagaacgcacttatatcatggtcaagcctgatggtgtccagcgaaac
ctcgttggcgaaattatcgggaggttcgaaaagcgtggattcaagctcactgccttgaag
ctcgtccatgcctcccccgagcatctcgagaagcactacgccgatcttgctggcaagccc
ttcttcccaggtctgatcaagtacatggcgtctggacctgtcgttgccatggtctgggaa
ggcttggatgctgtcaagacaggccgtgtgatgcttggtgcgactaaccctctgcagtcc
cccgtcggttccattcgtggtgactttgctttggcggttggccgcaacatttgccacggc
tcagattccgtcgagaatgctgaaaaggaaatcaaactttggttccctgaaggcaccatt
cagtacagtctcgcccaggaatccatgatatacgagtag

DBGET integrated database retrieval system